BLASTX nr result
ID: Rehmannia24_contig00017275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00017275 (336 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ11045.1| hypothetical protein PRUPE_ppa014697mg [Prunus pe... 58 1e-06 ref|XP_006858531.1| hypothetical protein AMTR_s00071p00157070 [A... 57 3e-06 gb|EOY22720.1| Bifunctional inhibitor/lipid-transfer protein/see... 56 6e-06 ref|XP_006440159.1| hypothetical protein CICLE_v10022946mg [Citr... 55 7e-06 gb|EOY22718.1| Bifunctional inhibitor/lipid-transfer protein/see... 55 1e-05 >gb|EMJ11045.1| hypothetical protein PRUPE_ppa014697mg [Prunus persica] Length = 118 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +1 Query: 1 PFVTWKLAAALGGVRRAIRLIESCGRNVPHNFKCGSVTTP 120 P VT K+AA + + RA+RLIE CGR VP +FKCGS+TTP Sbjct: 79 PVVTPKVAATIHDINRAVRLIEGCGRRVPRHFKCGSITTP 118 >ref|XP_006858531.1| hypothetical protein AMTR_s00071p00157070 [Amborella trichopoda] gi|548862640|gb|ERN19998.1| hypothetical protein AMTR_s00071p00157070 [Amborella trichopoda] Length = 111 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +1 Query: 1 PFVTWKLAAALGGVRRAIRLIESCGRNVPHNFKCGSVTTP 120 P VT KLAA L VRRA+RL+E CGR VP +FKCGSVTTP Sbjct: 73 PKVTPKLAA-LVDVRRAVRLVEGCGRRVPRHFKCGSVTTP 111 >gb|EOY22720.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 110 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = +1 Query: 1 PFVTWKLAAALGGVRRAIRLIESCGRNVPHNFKCGSVTTP 120 P +T +LAA +G V R I+ IE CGR VPHNFKCGS+TTP Sbjct: 72 PVITPQLAALIG-VERTIKQIEGCGRAVPHNFKCGSITTP 110 >ref|XP_006440159.1| hypothetical protein CICLE_v10022946mg [Citrus clementina] gi|568846458|ref|XP_006477071.1| PREDICTED: uncharacterized protein LOC102623440 [Citrus sinensis] gi|557542421|gb|ESR53399.1| hypothetical protein CICLE_v10022946mg [Citrus clementina] Length = 112 Score = 55.5 bits (132), Expect = 7e-06 Identities = 27/40 (67%), Positives = 31/40 (77%) Frame = +1 Query: 1 PFVTWKLAAALGGVRRAIRLIESCGRNVPHNFKCGSVTTP 120 P +T KLAA + V RAIRLIE CGR VP +FKCGS+TTP Sbjct: 74 PVITPKLAALID-VNRAIRLIEGCGRRVPRHFKCGSITTP 112 >gb|EOY22718.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Theobroma cacao] Length = 111 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = +1 Query: 1 PFVTWKLAAALGGVRRAIRLIESCGRNVPHNFKCGSVTTP 120 P VT KLAA +G V R I+ IE CGR VPH FKCGS+TTP Sbjct: 73 PVVTPKLAALIG-VERTIKQIEGCGRVVPHKFKCGSITTP 111