BLASTX nr result
ID: Rehmannia24_contig00016816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00016816 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002325431.2| hypothetical protein POPTR_0019s05510g [Popu... 57 2e-06 ref|XP_002525700.1| conserved hypothetical protein [Ricinus comm... 55 7e-06 ref|XP_004493204.1| PREDICTED: 2-aminoethanethiol dioxygenase-li... 55 1e-05 >ref|XP_002325431.2| hypothetical protein POPTR_0019s05510g [Populus trichocarpa] gi|550316870|gb|EEE99812.2| hypothetical protein POPTR_0019s05510g [Populus trichocarpa] Length = 236 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = +3 Query: 24 LDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 152 L N E+ K+ G CY WLEE E+P+ S+MDGIEY+GPQ+ S Sbjct: 192 LSNGEMELKKEEGSCYAWLEETEVPENSKMDGIEYLGPQVDES 234 >ref|XP_002525700.1| conserved hypothetical protein [Ricinus communis] gi|223535000|gb|EEF36683.1| conserved hypothetical protein [Ricinus communis] Length = 251 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 9 PCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQIINS 152 PC + N E+ ++ G Y WLEEIE+P+ S+MDGI Y+GPQI+ S Sbjct: 203 PCSAI-SNGEMKLTEEEGNSYGWLEEIEMPENSQMDGIRYLGPQIVES 249 >ref|XP_004493204.1| PREDICTED: 2-aminoethanethiol dioxygenase-like [Cicer arietinum] Length = 286 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = +3 Query: 9 PCDVLLDNEELTKVKDLGGCYRWLEEIEIPKESEMDGIEYMGPQI 143 PCD + EE+ KV D Y LEEIE+P+ +MDGIEY+GP I Sbjct: 237 PCDAFPNEEEIAKVNDKNDSYALLEEIEMPENCQMDGIEYLGPPI 281