BLASTX nr result
ID: Rehmannia24_contig00016629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00016629 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58705.1| hypothetical protein M569_16108 [Genlisea aurea] 63 4e-08 emb|CAC28528.1| GATA-1 zinc finger protein [Nicotiana tabacum] 59 9e-07 >gb|EPS58705.1| hypothetical protein M569_16108 [Genlisea aurea] Length = 94 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 10/66 (15%) Frame = +2 Query: 176 MSMVKPGNCWEA----------VANGIAGDEEFDNILNILDFPMESLEDDGFVADWDISK 325 MS+++PGN W+ V G+A DE ++N+ ++LDFPME D F DWDI+K Sbjct: 1 MSVIRPGNYWDFDGGGGGGGGDVVAGMARDESYENLFSLLDFPME----DDFAGDWDITK 56 Query: 326 SHCLGP 343 S CLGP Sbjct: 57 SQCLGP 62 >emb|CAC28528.1| GATA-1 zinc finger protein [Nicotiana tabacum] Length = 305 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = +2 Query: 176 MSMVKPGNCWEAVANGIAGDEEFDNILNILDFPMESLEDDGFVADWDISKSHCLGP 343 M+MV + + G DE+FD+ILN LDFP+ESLE+DG +WD S+S LGP Sbjct: 2 MTMVGHCGYLDGIPTGPVVDEDFDDILNFLDFPLESLEEDGQGVEWDASESKFLGP 57