BLASTX nr result
ID: Rehmannia24_contig00016350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00016350 (371 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233516.1| PREDICTED: F-box protein At5g49610-like isof... 57 2e-06 >ref|XP_004233516.1| PREDICTED: F-box protein At5g49610-like isoform 1 [Solanum lycopersicum] gi|460375446|ref|XP_004233517.1| PREDICTED: F-box protein At5g49610-like isoform 2 [Solanum lycopersicum] Length = 407 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/82 (41%), Positives = 50/82 (60%), Gaps = 1/82 (1%) Frame = +3 Query: 6 ICSGMELSLKRLMSVRIGPALDHITGYRVLPCPDGDTVMILVRCFIYSFSIGDRSIRVVS 185 I GME+SLKR +S+ +GP +VLPC + DTV I VR IY + I R +V S Sbjct: 321 IYQGMEMSLKRSVSINLGPERGLTCACKVLPCVNSDTVAIQVREHIYLYHI--REQKVES 378 Query: 186 RVASDSVG-ADKYLAYVNSLVH 248 + +++G A ++L Y+NSL + Sbjct: 379 IASPNAIGPAKRFLPYINSLAN 400