BLASTX nr result
ID: Rehmannia24_contig00015248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00015248 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlise... 77 2e-12 ref|XP_006351217.1| PREDICTED: transcription factor bHLH48-like ... 56 4e-06 >gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlisea aurea] Length = 239 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/59 (71%), Positives = 47/59 (79%), Gaps = 1/59 (1%) Frame = -1 Query: 259 QLQFRSGISGPKHGE-MGFGFDEIHGPISGPPETDNSSFTALLELPPPQAVELLIKEDF 86 + QFRS PK GE MGF DEI G IS PPET++SSFTALLELPPP+AVELL+KEDF Sbjct: 7 EAQFRSA---PKDGEEMGFVLDEIQGLISVPPETESSSFTALLELPPPKAVELLVKEDF 62 >ref|XP_006351217.1| PREDICTED: transcription factor bHLH48-like [Solanum tuberosum] Length = 360 Score = 56.2 bits (134), Expect = 4e-06 Identities = 41/109 (37%), Positives = 56/109 (51%), Gaps = 15/109 (13%) Frame = -1 Query: 283 MERRVEATQL-QFRSGISGPKHGEMGFGFDEIHGPISGPPETDNSSFTALLELPPPQAVE 107 M+ +E+ + + RS G + GE+G GF + I SSFTALL LPP QAVE Sbjct: 1 MDNLIESIEAGEARSENCGARMGEIGTGFHQFGEEILSVTSEGGSSFTALLGLPPNQAVE 60 Query: 106 LLIK--------------EDFXXXXXXXXXXPSNIALIDRASKFSIYAS 2 LL++ + PS+IALIDRASKFS++A+ Sbjct: 61 LLVQSPEADKMTSDKLAISEPHYRYPPPPIFPSDIALIDRASKFSVFAA 109