BLASTX nr result
ID: Rehmannia24_contig00015247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00015247 (853 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlise... 77 8e-12 >gb|EPS67147.1| hypothetical protein M569_07631, partial [Genlisea aurea] Length = 239 Score = 77.0 bits (188), Expect = 8e-12 Identities = 42/61 (68%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Frame = -1 Query: 265 VTQPQFRSGISEPKPGE-MGFGFDEIHGPISGPPETDNRSFTALLELPPPQAVELLIKED 89 V + QFRS PK GE MGF DEI G IS PPET++ SFTALLELPPP+AVELL+KED Sbjct: 5 VVEAQFRSA---PKDGEEMGFVLDEIQGLISVPPETESSSFTALLELPPPKAVELLVKED 61 Query: 88 F 86 F Sbjct: 62 F 62