BLASTX nr result
ID: Rehmannia24_contig00014667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00014667 (411 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535142.1| conserved hypothetical protein [Ricinus comm... 57 5e-13 >ref|XP_002535142.1| conserved hypothetical protein [Ricinus communis] gi|223523947|gb|EEF27248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 57.0 bits (136), Expect(2) = 5e-13 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 207 EKSAVIYLDQFPEALEIQTGSENHFSLWRPPFQSLRKN 320 E+ AVIYLDQFPEALEIQTGSENH+ L RP F+ R + Sbjct: 28 EERAVIYLDQFPEALEIQTGSENHWRLRRPSFRQQRSH 65 Score = 42.7 bits (99), Expect(2) = 5e-13 Identities = 21/27 (77%), Positives = 21/27 (77%) Frame = +1 Query: 124 RGFGSLYFRAGREVKAIREDCPPGKEE 204 RG G YF REVKAIREDCPPGKEE Sbjct: 4 RGAG-FYFLTEREVKAIREDCPPGKEE 29