BLASTX nr result
ID: Rehmannia24_contig00013390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00013390 (406 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73312.1| hypothetical protein VITISV_012096 [Vitis vinifera] 60 4e-07 >emb|CAN73312.1| hypothetical protein VITISV_012096 [Vitis vinifera] Length = 1817 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/45 (68%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 400 SSPGPNPAKPERPPLTKKSKTTASGSDDSQP-PHFPGPLFPAVRR 269 S+P PNP K ERPP+ KKS+T SDD P PHFPGPLFPAVRR Sbjct: 17 SNPKPNPNKYERPPVLKKSRTI---SDDVVPAPHFPGPLFPAVRR 58