BLASTX nr result
ID: Rehmannia24_contig00013174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00013174 (1110 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006426943.1| hypothetical protein CICLE_v10025322mg [Citr... 60 2e-06 >ref|XP_006426943.1| hypothetical protein CICLE_v10025322mg [Citrus clementina] gi|557528933|gb|ESR40183.1| hypothetical protein CICLE_v10025322mg [Citrus clementina] Length = 542 Score = 59.7 bits (143), Expect = 2e-06 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 2/113 (1%) Frame = +1 Query: 58 STKSFDSFSCNFPCLEELSLFFCSGFEEFQLSSRSIKHLIIEGFDNSIKVVIDVPNIVSF 237 S + F NFP LE LSL FC E+ +SS +K L I+ N + + PN++SF Sbjct: 292 SDQEFHDLISNFPLLENLSLRFCCSLEKIMISSNRLKELCIDRCVNLKAIDLVTPNLLSF 351 Query: 238 HYEGDIPRSISFTTASSEWKSDIVVWSHVNFDYDAS--SWFLKLNELLKALSE 390 Y + + S TAS W+ V F+Y A+ SW++ + E L A ++ Sbjct: 352 TYVSNPVPTFSI-TASCPWR--------VAFNYGAADVSWYINMKEFLSASNQ 395