BLASTX nr result
ID: Rehmannia24_contig00012702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00012702 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534369.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002534369.1| conserved hypothetical protein [Ricinus communis] gi|223525419|gb|EEF28015.1| conserved hypothetical protein [Ricinus communis] Length = 136 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/91 (35%), Positives = 54/91 (59%), Gaps = 9/91 (9%) Frame = -1 Query: 386 EELTQANETIDENSLYLDIMGGENRNGIYGLGSQACEYYRT-NARPTLFEFGQQNSEQ-- 216 E+L+Q NE ++EN LY+ +GG++ +YGLGSQA E Y+T A +L F + Sbjct: 45 EKLSQINEIVNENELYMQSLGGQSNRWVYGLGSQASECYKTGGASSSLATFPPAQPAEPT 104 Query: 215 ------INELRERILQQDVVIKDLKDLTERL 141 +N+L+++I +Q+ +I L++ E L Sbjct: 105 PELLNTLNKLQQQITEQNQLIHFLQECCECL 135