BLASTX nr result
ID: Rehmannia24_contig00012579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00012579 (450 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW11481.1| hypothetical protein PHAVU_008G033600g [Phaseolus... 57 3e-06 ref|XP_006431293.1| hypothetical protein CICLE_v10011374mg [Citr... 57 3e-06 >gb|ESW11481.1| hypothetical protein PHAVU_008G033600g [Phaseolus vulgaris] Length = 634 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +3 Query: 75 LAKDKRS-QKRKFQELPAATKGPANPNQVFSLTFYEAYRLIMDLYVGNL 218 + K+KR QKRKFQELP KG A N+VFSLTFYEA L +DL VG L Sbjct: 507 IEKEKRPPQKRKFQELPVGLKGTAKLNKVFSLTFYEAKSLTLDLSVGPL 555 >ref|XP_006431293.1| hypothetical protein CICLE_v10011374mg [Citrus clementina] gi|557533350|gb|ESR44533.1| hypothetical protein CICLE_v10011374mg [Citrus clementina] Length = 501 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/51 (62%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 81 KDKRS-QKRKFQELPAATKGPANPNQVFSLTFYEAYRLI--MDLYVGNLYV 224 K+KR QKRKFQELP +KGPA NQVFSLTFYEA R I + ++ LYV Sbjct: 451 KEKRPPQKRKFQELPVGSKGPAKHNQVFSLTFYEANRSISYLSVWTIGLYV 501