BLASTX nr result
ID: Rehmannia24_contig00011044
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00011044 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC55387.1| hypothetical protein L484_001187 [Morus notabilis] 56 6e-06 ref|XP_003541308.1| PREDICTED: probable zinc transporter protein... 56 6e-06 >gb|EXC55387.1| hypothetical protein L484_001187 [Morus notabilis] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 497 GIHEATSLDRVRKDSLQSSDITNGVYEDRIQMSPLPT 387 GI+EATSL+R R+DS Q+SDI+NG+ ED IQMS LPT Sbjct: 292 GIYEATSLERTRRDSSQTSDISNGILEDPIQMSSLPT 328 >ref|XP_003541308.1| PREDICTED: probable zinc transporter protein DDB_G0291141 isoform 1 [Glycine max] Length = 359 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/37 (64%), Positives = 35/37 (94%) Frame = -1 Query: 497 GIHEATSLDRVRKDSLQSSDITNGVYEDRIQMSPLPT 387 GI+EATSL+R RKDS+++SD++NG ++++IQMSPLPT Sbjct: 323 GIYEATSLERNRKDSIRNSDLSNGEFDNQIQMSPLPT 359