BLASTX nr result
ID: Rehmannia24_contig00010920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00010920 (313 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] 61 1e-07 emb|CBI32913.3| unnamed protein product [Vitis vinifera] 59 5e-07 >emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Length = 607 Score = 61.2 bits (147), Expect = 1e-07 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 11/115 (9%) Frame = -2 Query: 312 VKIDTPALRYLQLHDFISQDFSVGSLTSLIEADVIFDYDA------PADGEVLHSRSVLE 151 V +D P L YL + D++S+D+ V L SL++A + + D+ P +G + + + E Sbjct: 239 VVVDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYE 298 Query: 150 FVGRLCNVKCLKLSTSWMKVPNSTFSALTV-KFHNLTELEL----AVDWRFLSYF 1 +GR+ NVKCL L+ + + T + FHN+T LE +W FL F Sbjct: 299 LLGRISNVKCLSLTGVTLDSLSGTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNF 353 >emb|CBI32913.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 59.3 bits (142), Expect = 5e-07 Identities = 37/114 (32%), Positives = 60/114 (52%), Gaps = 10/114 (8%) Frame = -2 Query: 312 VKIDTPALRYLQLHDFISQDFSVGSLTSLIEADVIFDYDA------PADGEVLHSRSVLE 151 V +D P L YL + D++S+D+ V L SL++A + + D+ P +G + + + E Sbjct: 216 VVVDAPNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYE 275 Query: 150 FVGRLCNVKCLKLSTSWMKVPNSTFSALTVKFHNLTELEL----AVDWRFLSYF 1 +GR+ NVKCL L+ + V + + FHN+T LE +W FL F Sbjct: 276 LLGRISNVKCLSLTGVTLDV-SFLCPPILPTFHNMTCLEFLFIGGFNWDFLPNF 328