BLASTX nr result
ID: Rehmannia24_contig00010340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00010340 (332 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006467496.1| PREDICTED: high mobility group B protein 14-... 56 6e-06 ref|XP_006449663.1| hypothetical protein CICLE_v10017037mg [Citr... 56 6e-06 ref|XP_006449662.1| hypothetical protein CICLE_v10017037mg [Citr... 56 6e-06 gb|EOY27738.1| HMG-box DNA-binding family protein isoform 1 [The... 56 6e-06 ref|XP_002519708.1| DNA-binding protein MNB1B, putative [Ricinus... 55 1e-05 >ref|XP_006467496.1| PREDICTED: high mobility group B protein 14-like [Citrus sinensis] Length = 157 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 332 YEEKVKYYDIATEKRAAFETAMANFIKRKECG 237 YEEKVKYYDIATEKRA F+ AMA++IKRKE G Sbjct: 111 YEEKVKYYDIATEKRAEFDRAMADYIKRKENG 142 >ref|XP_006449663.1| hypothetical protein CICLE_v10017037mg [Citrus clementina] gi|557552274|gb|ESR62903.1| hypothetical protein CICLE_v10017037mg [Citrus clementina] Length = 157 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 332 YEEKVKYYDIATEKRAAFETAMANFIKRKECG 237 YEEKVKYYDIATEKRA F+ AMA++IKRKE G Sbjct: 111 YEEKVKYYDIATEKRAEFDRAMADYIKRKENG 142 >ref|XP_006449662.1| hypothetical protein CICLE_v10017037mg [Citrus clementina] gi|557552273|gb|ESR62902.1| hypothetical protein CICLE_v10017037mg [Citrus clementina] Length = 136 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 332 YEEKVKYYDIATEKRAAFETAMANFIKRKECG 237 YEEKVKYYDIATEKRA F+ AMA++IKRKE G Sbjct: 90 YEEKVKYYDIATEKRAEFDRAMADYIKRKENG 121 >gb|EOY27738.1| HMG-box DNA-binding family protein isoform 1 [Theobroma cacao] Length = 168 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 332 YEEKVKYYDIATEKRAAFETAMANFIKRKECG 237 YEEKVKYYDIATEKRA F+ AMA++IKRKE G Sbjct: 124 YEEKVKYYDIATEKRAEFDRAMADYIKRKENG 155 >ref|XP_002519708.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223541125|gb|EEF42681.1| DNA-binding protein MNB1B, putative [Ricinus communis] Length = 198 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -1 Query: 332 YEEKVKYYDIATEKRAAFETAMANFIKRKECG 237 YEEKVKYYDIATEKRA F+ AMA +IK+KE G Sbjct: 154 YEEKVKYYDIATEKRAEFDKAMAEYIKKKESG 185