BLASTX nr result
ID: Rehmannia24_contig00010070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00010070 (525 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71901.1| hypothetical protein M569_02857, partial [Genlise... 56 6e-06 >gb|EPS71901.1| hypothetical protein M569_02857, partial [Genlisea aurea] Length = 625 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/48 (54%), Positives = 29/48 (60%) Frame = +2 Query: 380 KVTSDRTYFDCKRLPLILEKEXXXXXXXXXXXXNCDVVLAGEDAPYQG 523 +V D TYFDCKRLP+ILE NCDV LAG+ APYQG Sbjct: 392 EVAGDCTYFDCKRLPMILENHELSSVPIGLPISNCDVFLAGQGAPYQG 439