BLASTX nr result
ID: Rehmannia24_contig00009610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00009610 (516 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617393.1| HAT family dimerization domain containing pr... 61 1e-07 gb|EMJ25577.1| hypothetical protein PRUPE_ppa020630mg, partial [... 61 2e-07 ref|XP_006369817.1| hypothetical protein POPTR_0001s32700g, part... 60 3e-07 gb|EMJ18166.1| hypothetical protein PRUPE_ppa015504mg, partial [... 60 4e-07 ref|XP_006442280.1| hypothetical protein CICLE_v10024402mg, part... 59 7e-07 ref|XP_006371200.1| hypothetical protein POPTR_0019s05600g [Popu... 58 2e-06 ref|XP_006446973.1| hypothetical protein CICLE_v10018193mg [Citr... 57 2e-06 gb|EMJ17246.1| hypothetical protein PRUPE_ppa017581mg, partial [... 57 3e-06 ref|XP_006441622.1| hypothetical protein CICLE_v10023860mg, part... 57 3e-06 ref|XP_006436710.1| hypothetical protein CICLE_v10030720mg [Citr... 57 3e-06 gb|EMJ04587.1| hypothetical protein PRUPE_ppa020793mg [Prunus pe... 56 4e-06 ref|XP_006421714.1| hypothetical protein CICLE_v10006518mg [Citr... 56 6e-06 ref|XP_006369740.1| hypothetical protein POPTR_0001s30480g [Popu... 56 6e-06 ref|XP_006368918.1| hypothetical protein POPTR_0001s14710g [Popu... 56 6e-06 ref|XP_006427514.1| hypothetical protein CICLE_v10027245mg [Citr... 55 7e-06 ref|XP_006423698.1| hypothetical protein CICLE_v10030246mg, part... 55 7e-06 gb|EMJ10021.1| hypothetical protein PRUPE_ppa025060mg [Prunus pe... 55 7e-06 ref|XP_006370443.1| hypothetical protein POPTR_0001s42600g [Popu... 55 1e-05 ref|XP_003609247.1| GTP-binding nuclear protein Ran-A1 [Medicago... 55 1e-05 >ref|XP_003617393.1| HAT family dimerization domain containing protein [Medicago truncatula] gi|355518728|gb|AET00352.1| HAT family dimerization domain containing protein [Medicago truncatula] Length = 94 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRL 96 PGLRP+IWDFP+NQRDEIRRAYL+ GP QP L Sbjct: 32 PGLRPMIWDFPVNQRDEIRRAYLRRGPCQPIL 63 >gb|EMJ25577.1| hypothetical protein PRUPE_ppa020630mg, partial [Prunus persica] Length = 615 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKNQHHQFQTYHL 162 PG+RP IW++P+NQRDEIRRAY+ VGPYQP L + S+ + Q + L Sbjct: 9 PGIRPQIWNYPVNQRDEIRRAYINVGPYQPILSKYPKFGSVTHQRSFQSSWFKL 62 >ref|XP_006369817.1| hypothetical protein POPTR_0001s32700g, partial [Populus trichocarpa] gi|550348725|gb|ERP66386.1| hypothetical protein POPTR_0001s32700g, partial [Populus trichocarpa] Length = 689 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKNQHHQFQ 150 PGLR L+W PINQ+DEIRRAY+K+GPYQP+L + Y + Q+ +FQ Sbjct: 1 PGLRILVWKHPINQQDEIRRAYIKMGPYQPKLAE--YPRTESGRQYRRFQ 48 >gb|EMJ18166.1| hypothetical protein PRUPE_ppa015504mg, partial [Prunus persica] Length = 761 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRL 96 PGLRP IW++P+NQRDEIRR Y+ VGPYQP L Sbjct: 9 PGLRPQIWNYPVNQRDEIRRVYINVGPYQPIL 40 >ref|XP_006442280.1| hypothetical protein CICLE_v10024402mg, partial [Citrus clementina] gi|557544542|gb|ESR55520.1| hypothetical protein CICLE_v10024402mg, partial [Citrus clementina] Length = 308 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLR IWD+ +NQRDE+RRAY+ GPYQPRLP+ Sbjct: 15 PGLRHQIWDYNVNQRDEMRRAYIMSGPYQPRLPE 48 >ref|XP_006371200.1| hypothetical protein POPTR_0019s05600g [Populus trichocarpa] gi|550316878|gb|ERP48997.1| hypothetical protein POPTR_0019s05600g [Populus trichocarpa] Length = 743 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/52 (48%), Positives = 36/52 (69%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKNQHHQFQTY 156 PG RP IW++P+NQ+DEIRRAY+ +GPYQP + + GK +FQ++ Sbjct: 68 PGNRPQIWEYPVNQQDEIRRAYINLGPYQPLMSEYPL---TGKKHPRRFQSH 116 >ref|XP_006446973.1| hypothetical protein CICLE_v10018193mg [Citrus clementina] gi|557549584|gb|ESR60213.1| hypothetical protein CICLE_v10018193mg [Citrus clementina] Length = 775 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLRP IW + +NQRD+IRR+Y+ VGPYQPRL + Sbjct: 81 PGLRPQIWVYDVNQRDQIRRSYIMVGPYQPRLSE 114 >gb|EMJ17246.1| hypothetical protein PRUPE_ppa017581mg, partial [Prunus persica] Length = 713 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 4 GLRPLIWDFPINQRDEIRRAYLKVGPYQPRL 96 GLRP IW++P+NQRDEIRR Y+ VGPYQP L Sbjct: 10 GLRPQIWNYPVNQRDEIRRVYINVGPYQPIL 40 >ref|XP_006441622.1| hypothetical protein CICLE_v10023860mg, partial [Citrus clementina] gi|557543884|gb|ESR54862.1| hypothetical protein CICLE_v10023860mg, partial [Citrus clementina] Length = 643 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLRP IW + +NQ+DEIRRAY+ GPYQPRL + Sbjct: 3 PGLRPQIWVYDVNQQDEIRRAYIMAGPYQPRLSE 36 >ref|XP_006436710.1| hypothetical protein CICLE_v10030720mg [Citrus clementina] gi|557538906|gb|ESR49950.1| hypothetical protein CICLE_v10030720mg [Citrus clementina] Length = 814 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLRP IW +NQRDEIRRAY+ GPYQPRL + Sbjct: 62 PGLRPQIWVHDVNQRDEIRRAYIMAGPYQPRLSE 95 >gb|EMJ04587.1| hypothetical protein PRUPE_ppa020793mg [Prunus persica] Length = 482 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/54 (48%), Positives = 35/54 (64%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKNQHHQFQTYHL 162 PG RP IW++ +NQRDEIRRAY+K PYQPRL + S+ ++ Q + L Sbjct: 20 PGPRPQIWNYLVNQRDEIRRAYIKASPYQPRLSKYPKSGSVTHQRNFQSSWFKL 73 >ref|XP_006421714.1| hypothetical protein CICLE_v10006518mg [Citrus clementina] gi|557523587|gb|ESR34954.1| hypothetical protein CICLE_v10006518mg [Citrus clementina] Length = 778 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLRP IW +NQRDEIRRAY+ GPYQPR+ + Sbjct: 62 PGLRPQIWVHDVNQRDEIRRAYIMAGPYQPRISE 95 >ref|XP_006369740.1| hypothetical protein POPTR_0001s30480g [Populus trichocarpa] gi|550348552|gb|ERP66309.1| hypothetical protein POPTR_0001s30480g [Populus trichocarpa] Length = 719 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKN----QHHQFQTYHLVD 168 P RP IW++P+NQ+DEIRRAY+ +GPYQP + + Y + K+ Q H F++Y ++ Sbjct: 19 PSNRPQIWEYPVNQQDEIRRAYINLGPYQPLMSE--YPLTGNKHRRRFQSHWFKSYPWLE 76 Query: 169 RS 174 S Sbjct: 77 YS 78 >ref|XP_006368918.1| hypothetical protein POPTR_0001s14710g [Populus trichocarpa] gi|550347267|gb|ERP65487.1| hypothetical protein POPTR_0001s14710g [Populus trichocarpa] Length = 719 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKNQHHQFQTY 156 P RP IW++P+NQ+DEIRRAY+ +GPYQP + + GK + +FQ++ Sbjct: 34 PSNRPQIWEYPVNQQDEIRRAYINLGPYQPLMSEYPL---TGKKRPRRFQSH 82 >ref|XP_006427514.1| hypothetical protein CICLE_v10027245mg [Citrus clementina] gi|557529504|gb|ESR40754.1| hypothetical protein CICLE_v10027245mg [Citrus clementina] Length = 797 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGL IWD+ +NQ DEIRRAY+ GPYQPRLP+ Sbjct: 62 PGLHCQIWDYDVNQGDEIRRAYIMSGPYQPRLPE 95 >ref|XP_006423698.1| hypothetical protein CICLE_v10030246mg, partial [Citrus clementina] gi|557525632|gb|ESR36938.1| hypothetical protein CICLE_v10030246mg, partial [Citrus clementina] Length = 681 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQ 102 PGLRP IW + INQRDEI RAY+ GPYQPRL + Sbjct: 9 PGLRPQIWVYDINQRDEICRAYIMAGPYQPRLSE 42 >gb|EMJ10021.1| hypothetical protein PRUPE_ppa025060mg [Prunus persica] Length = 746 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = +1 Query: 4 GLRPLIWDFPINQRDEIRRAYLKVGPYQPRL 96 GLRP IW++P+NQRDEIRRAY+ VG YQP L Sbjct: 29 GLRPQIWNYPVNQRDEIRRAYINVGSYQPIL 59 >ref|XP_006370443.1| hypothetical protein POPTR_0001s42600g [Populus trichocarpa] gi|550349624|gb|ERP67012.1| hypothetical protein POPTR_0001s42600g [Populus trichocarpa] Length = 588 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/62 (43%), Positives = 41/62 (66%), Gaps = 4/62 (6%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRLPQDAYLFSIGKN----QHHQFQTYHLVD 168 P RP IW++P+NQ+DEIRRAY+ +GPYQP + + Y + K+ Q H F++Y ++ Sbjct: 68 PSNRPQIWEYPVNQQDEIRRAYINLGPYQPLMSE--YPMTGEKHPRRFQSHWFKSYPWLE 125 Query: 169 RS 174 S Sbjct: 126 YS 127 >ref|XP_003609247.1| GTP-binding nuclear protein Ran-A1 [Medicago truncatula] gi|355510302|gb|AES91444.1| GTP-binding nuclear protein Ran-A1 [Medicago truncatula] Length = 350 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 PGLRPLIWDFPINQRDEIRRAYLKVGPYQPRL 96 P L+P+IWDFPINQRDEIR AYLK GP QP L Sbjct: 75 PELQPMIWDFPINQRDEIRCAYLKHGPCQPIL 106