BLASTX nr result
ID: Rehmannia24_contig00009347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00009347 (369 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322889.1| hypothetical protein POPTR_0016s09330g [Popu... 65 9e-09 ref|XP_002519498.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_006845882.1| hypothetical protein AMTR_s00154p00077880 [A... 63 5e-08 ref|XP_006298868.1| hypothetical protein CARUB_v10014987mg [Caps... 63 5e-08 ref|XP_006428392.1| hypothetical protein CICLE_v10013190mg [Citr... 61 2e-07 ref|XP_002282270.1| PREDICTED: uncharacterized protein LOC100249... 61 2e-07 ref|XP_006407629.1| hypothetical protein EUTSA_v10022256mg [Eutr... 60 2e-07 ref|NP_187597.2| uncharacterized protein [Arabidopsis thaliana] ... 60 2e-07 gb|EMJ08712.1| hypothetical protein PRUPE_ppa013859mg [Prunus pe... 59 7e-07 ref|XP_006354363.1| PREDICTED: uncharacterized protein LOC102603... 57 2e-06 ref|XP_004246633.1| PREDICTED: uncharacterized protein LOC101263... 57 2e-06 ref|XP_004137838.1| PREDICTED: uncharacterized protein LOC101220... 57 2e-06 >ref|XP_002322889.1| hypothetical protein POPTR_0016s09330g [Populus trichocarpa] gi|118485830|gb|ABK94762.1| unknown [Populus trichocarpa] gi|222867519|gb|EEF04650.1| hypothetical protein POPTR_0016s09330g [Populus trichocarpa] Length = 98 Score = 65.1 bits (157), Expect = 9e-09 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 367 EKNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 +K +PYKFKWN+M REVRDSYYFNWP+YFP Sbjct: 69 KKKEPYKFKWNKMDREVRDSYYFNWPIYFP 98 >ref|XP_002519498.1| conserved hypothetical protein [Ricinus communis] gi|223541361|gb|EEF42912.1| conserved hypothetical protein [Ricinus communis] Length = 98 Score = 64.3 bits (155), Expect = 2e-08 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -3 Query: 367 EKNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 +KN+PYKFKWN+M REVRD+YY NWP+YFP Sbjct: 69 KKNEPYKFKWNEMDREVRDNYYINWPIYFP 98 >ref|XP_006845882.1| hypothetical protein AMTR_s00154p00077880 [Amborella trichopoda] gi|548848526|gb|ERN07557.1| hypothetical protein AMTR_s00154p00077880 [Amborella trichopoda] Length = 98 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -3 Query: 367 EKNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 EK + Y+FKWNQM +EVRDSYYFNWPVYFP Sbjct: 69 EKGEAYQFKWNQMKKEVRDSYYFNWPVYFP 98 >ref|XP_006298868.1| hypothetical protein CARUB_v10014987mg [Capsella rubella] gi|482567577|gb|EOA31766.1| hypothetical protein CARUB_v10014987mg [Capsella rubella] Length = 98 Score = 62.8 bits (151), Expect = 5e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 364 KNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 KNQPY+FKWN++ +EVRDSYY+NWPVYFP Sbjct: 70 KNQPYEFKWNKIPKEVRDSYYYNWPVYFP 98 >ref|XP_006428392.1| hypothetical protein CICLE_v10013190mg [Citrus clementina] gi|568880172|ref|XP_006493008.1| PREDICTED: uncharacterized protein LOC102625587 [Citrus sinensis] gi|557530449|gb|ESR41632.1| hypothetical protein CICLE_v10013190mg [Citrus clementina] Length = 99 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -3 Query: 364 KNQPYKFKWNQ-MSREVRDSYYFNWPVYFP 278 K QPYKFKWN+ M RE+RDSYYFNWPVYFP Sbjct: 70 KKQPYKFKWNEYMDRELRDSYYFNWPVYFP 99 >ref|XP_002282270.1| PREDICTED: uncharacterized protein LOC100249954 isoform 1 [Vitis vinifera] gi|359481400|ref|XP_003632615.1| PREDICTED: uncharacterized protein LOC100249954 isoform 2 [Vitis vinifera] gi|297741640|emb|CBI32772.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/30 (83%), Positives = 27/30 (90%), Gaps = 1/30 (3%) Frame = -3 Query: 364 KNQPYKFKWNQ-MSREVRDSYYFNWPVYFP 278 K QPYKFKWNQ M R++RDSYYFNWPVYFP Sbjct: 70 KKQPYKFKWNQYMDRDLRDSYYFNWPVYFP 99 >ref|XP_006407629.1| hypothetical protein EUTSA_v10022256mg [Eutrema salsugineum] gi|557108775|gb|ESQ49082.1| hypothetical protein EUTSA_v10022256mg [Eutrema salsugineum] Length = 98 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 364 KNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 K QPY+FKWN++ +EVRDSYY+NWPVYFP Sbjct: 70 KKQPYEFKWNKIPKEVRDSYYYNWPVYFP 98 >ref|NP_187597.2| uncharacterized protein [Arabidopsis thaliana] gi|297829518|ref|XP_002882641.1| hypothetical protein ARALYDRAFT_897150 [Arabidopsis lyrata subsp. lyrata] gi|48310049|gb|AAT41743.1| At3g09860 [Arabidopsis thaliana] gi|52218784|gb|AAU29462.1| At3g09860 [Arabidopsis thaliana] gi|110742123|dbj|BAE98991.1| hypothetical protein [Arabidopsis thaliana] gi|297328481|gb|EFH58900.1| hypothetical protein ARALYDRAFT_897150 [Arabidopsis lyrata subsp. lyrata] gi|332641301|gb|AEE74822.1| uncharacterized protein AT3G09860 [Arabidopsis thaliana] Length = 98 Score = 60.5 bits (145), Expect = 2e-07 Identities = 22/29 (75%), Positives = 27/29 (93%) Frame = -3 Query: 364 KNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 K QPY+FKWN++ +EVRDSYY+NWPVYFP Sbjct: 70 KKQPYEFKWNKIPKEVRDSYYYNWPVYFP 98 >gb|EMJ08712.1| hypothetical protein PRUPE_ppa013859mg [Prunus persica] Length = 99 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 1/31 (3%) Frame = -3 Query: 367 EKNQPYKFKWNQ-MSREVRDSYYFNWPVYFP 278 +K +PYKFKWNQ M +++RDSYYFNWPVYFP Sbjct: 69 KKGEPYKFKWNQYMDKDLRDSYYFNWPVYFP 99 >ref|XP_006354363.1| PREDICTED: uncharacterized protein LOC102603639 [Solanum tuberosum] Length = 99 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = -3 Query: 367 EKNQPYKFKWNQ-MSREVRDSYYFNWPVYFP 278 +KNQ Y+FKWNQ M ++ RDSYYFNWPVYFP Sbjct: 69 KKNQDYEFKWNQYMDKDARDSYYFNWPVYFP 99 >ref|XP_004246633.1| PREDICTED: uncharacterized protein LOC101263743 isoform 2 [Solanum lycopersicum] Length = 99 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = -3 Query: 367 EKNQPYKFKWNQ-MSREVRDSYYFNWPVYFP 278 +KNQ Y+FKWNQ M ++ RDSYYFNWPVYFP Sbjct: 69 KKNQDYEFKWNQYMDKDTRDSYYFNWPVYFP 99 >ref|XP_004137838.1| PREDICTED: uncharacterized protein LOC101220739 [Cucumis sativus] gi|449518282|ref|XP_004166171.1| PREDICTED: uncharacterized LOC101220739 [Cucumis sativus] Length = 98 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -3 Query: 367 EKNQPYKFKWNQMSREVRDSYYFNWPVYFP 278 EKN+PY+F WN+M RE+RDSYYFN P++FP Sbjct: 69 EKNKPYQFTWNKMDRELRDSYYFNMPIFFP 98