BLASTX nr result
ID: Rehmannia24_contig00008457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00008457 (354 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482689.1| PREDICTED: chaperone protein ClpB3, chloropl... 123 3e-26 ref|XP_006431231.1| hypothetical protein CICLE_v10010991mg [Citr... 120 2e-25 emb|CBI22284.3| unnamed protein product [Vitis vinifera] 115 6e-24 ref|XP_002284243.1| PREDICTED: chaperone protein ClpB3, chloropl... 115 6e-24 emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] 115 6e-24 ref|NP_001234143.1| heat shock protein [Solanum lycopersicum] gi... 114 1e-23 gb|EXB38073.1| Chaperone protein [Morus notabilis] 114 2e-23 ref|XP_002526076.1| chaperone clpb, putative [Ricinus communis] ... 112 4e-23 ref|XP_006338388.1| PREDICTED: chaperone protein ClpB3, chloropl... 110 2e-22 ref|XP_002324092.1| hypothetical protein POPTR_0017s12630g [Popu... 110 3e-22 gb|EOY03603.1| Casein lytic proteinase B3 isoform 2 [Theobroma c... 108 6e-22 gb|EOY03602.1| Casein lytic proteinase B3 isoform 1 [Theobroma c... 108 6e-22 ref|XP_003543903.1| PREDICTED: chaperone protein ClpB3, chloropl... 107 1e-21 ref|XP_004304250.1| PREDICTED: chaperone protein ClpB3, chloropl... 107 2e-21 gb|EMJ16121.1| hypothetical protein PRUPE_ppa000855mg [Prunus pe... 107 2e-21 ref|XP_002305376.1| hypothetical protein POPTR_0004s12360g [Popu... 105 5e-21 gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] gi|2... 105 6e-21 ref|XP_003554908.1| PREDICTED: chaperone protein ClpB3, chloropl... 105 6e-21 ref|NP_568314.1| chaperone protein ClpB3 [Arabidopsis thaliana] ... 105 6e-21 ref|XP_002873724.1| APG6/CLPB-P/CLPB3 [Arabidopsis lyrata subsp.... 105 8e-21 >ref|XP_006482689.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like isoform X1 [Citrus sinensis] gi|568858297|ref|XP_006482690.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like isoform X2 [Citrus sinensis] Length = 973 Score = 123 bits (308), Expect = 3e-26 Identities = 62/75 (82%), Positives = 67/75 (89%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQYVENELAKGILRGEFKDED I IDTEVTAFSNGQLPQQKLVFR+L++ S Sbjct: 899 GARPVKRVIQQYVENELAKGILRGEFKDEDTIVIDTEVTAFSNGQLPQQKLVFRRLDTSS 958 Query: 172 DLSSENRGAAFSQTA 128 D S+ + AFSQTA Sbjct: 959 DASAADNQEAFSQTA 973 >ref|XP_006431231.1| hypothetical protein CICLE_v10010991mg [Citrus clementina] gi|557533288|gb|ESR44471.1| hypothetical protein CICLE_v10010991mg [Citrus clementina] Length = 973 Score = 120 bits (300), Expect = 2e-25 Identities = 60/75 (80%), Positives = 66/75 (88%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQYVENELAKGILRGEFKD+D I DTEVTAFSNGQLPQQKLVFR+L++ S Sbjct: 899 GARPVKRVIQQYVENELAKGILRGEFKDDDTIVTDTEVTAFSNGQLPQQKLVFRRLDTSS 958 Query: 172 DLSSENRGAAFSQTA 128 D S+ + AFSQTA Sbjct: 959 DASAADNQEAFSQTA 973 >emb|CBI22284.3| unnamed protein product [Vitis vinifera] Length = 875 Score = 115 bits (288), Expect = 6e-24 Identities = 59/74 (79%), Positives = 62/74 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED + IDTEVTAFSNGQLPQQKL+ RKLES S Sbjct: 801 GARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKLESDS 860 Query: 172 DLSSENRGAAFSQT 131 D + AFSQT Sbjct: 861 DTPAAEGQEAFSQT 874 >ref|XP_002284243.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Vitis vinifera] Length = 976 Score = 115 bits (288), Expect = 6e-24 Identities = 59/74 (79%), Positives = 62/74 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED + IDTEVTAFSNGQLPQQKL+ RKLES S Sbjct: 902 GARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKLESDS 961 Query: 172 DLSSENRGAAFSQT 131 D + AFSQT Sbjct: 962 DTPAAEGQEAFSQT 975 >emb|CAN69514.1| hypothetical protein VITISV_009951 [Vitis vinifera] Length = 790 Score = 115 bits (288), Expect = 6e-24 Identities = 59/74 (79%), Positives = 62/74 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED + IDTEVTAFSNGQLPQQKL+ RKLES S Sbjct: 716 GARPVKRVIQQNVENELAKGILRGEFKDEDTVLIDTEVTAFSNGQLPQQKLILRKLESDS 775 Query: 172 DLSSENRGAAFSQT 131 D + AFSQT Sbjct: 776 DTPAAEGQEAFSQT 789 >ref|NP_001234143.1| heat shock protein [Solanum lycopersicum] gi|68989120|dbj|BAE06227.1| heat shock protein [Solanum lycopersicum] Length = 980 Score = 114 bits (285), Expect = 1e-23 Identities = 59/73 (80%), Positives = 65/73 (89%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED I +DTEV+AFSNGQLPQQKLVF++ ESGS Sbjct: 907 GARPVKRVIQQNVENELAKGILRGEFKDEDTILVDTEVSAFSNGQLPQQKLVFKRQESGS 966 Query: 172 DLSSENRGAAFSQ 134 D +EN+ AFSQ Sbjct: 967 DSPAENQ-EAFSQ 978 >gb|EXB38073.1| Chaperone protein [Morus notabilis] Length = 959 Score = 114 bits (284), Expect = 2e-23 Identities = 58/74 (78%), Positives = 63/74 (85%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRG+FK+ED + IDTEVTAFSNGQLPQQKLVFRKLESGS Sbjct: 885 GARPVKRVIQQNVENELAKGILRGDFKEEDTVLIDTEVTAFSNGQLPQQKLVFRKLESGS 944 Query: 172 DLSSENRGAAFSQT 131 + + AFS T Sbjct: 945 ESQAAEDQEAFSGT 958 >ref|XP_002526076.1| chaperone clpb, putative [Ricinus communis] gi|223534573|gb|EEF36270.1| chaperone clpb, putative [Ricinus communis] Length = 973 Score = 112 bits (281), Expect = 4e-23 Identities = 59/75 (78%), Positives = 67/75 (89%), Gaps = 1/75 (1%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQYVENELAKGILRGEFKDED + IDTEVTAFSNGQLPQQKLVF+++ES + Sbjct: 900 GARPVKRVIQQYVENELAKGILRGEFKDEDAVLIDTEVTAFSNGQLPQQKLVFKRIESDA 959 Query: 172 D-LSSENRGAAFSQT 131 D +++NR A SQT Sbjct: 960 DTAAADNR--ALSQT 972 >ref|XP_006338388.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Solanum tuberosum] Length = 979 Score = 110 bits (276), Expect = 2e-22 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED I +DTEV+AFSNGQLPQQKLVF++ ES S Sbjct: 906 GARPVKRVIQQNVENELAKGILRGEFKDEDTILVDTEVSAFSNGQLPQQKLVFKRQESCS 965 Query: 172 DLSSENRGAAFSQ 134 D +EN+ AFSQ Sbjct: 966 DSPAENQ-EAFSQ 977 >ref|XP_002324092.1| hypothetical protein POPTR_0017s12630g [Populus trichocarpa] gi|222867094|gb|EEF04225.1| hypothetical protein POPTR_0017s12630g [Populus trichocarpa] Length = 949 Score = 110 bits (274), Expect = 3e-22 Identities = 56/75 (74%), Positives = 67/75 (89%), Gaps = 1/75 (1%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQYVENELAKGILRGEFKDED++ IDTEVTAF+NGQLPQQKLVF++L++ Sbjct: 876 GARPVKRVIQQYVENELAKGILRGEFKDEDSVLIDTEVTAFANGQLPQQKLVFKRLQTSE 935 Query: 172 D-LSSENRGAAFSQT 131 + ++ENR FS+T Sbjct: 936 EKAAAENR--VFSRT 948 >gb|EOY03603.1| Casein lytic proteinase B3 isoform 2 [Theobroma cacao] Length = 725 Score = 108 bits (271), Expect = 6e-22 Identities = 53/74 (71%), Positives = 63/74 (85%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED+I +DTE+TAF+NGQLPQQKL+FR+L+ S Sbjct: 651 GARPVKRVIQQNVENELAKGILRGEFKDEDSILVDTELTAFANGQLPQQKLIFRRLDRDS 710 Query: 172 DLSSENRGAAFSQT 131 + + + A SQT Sbjct: 711 ETQATDSEEALSQT 724 >gb|EOY03602.1| Casein lytic proteinase B3 isoform 1 [Theobroma cacao] Length = 974 Score = 108 bits (271), Expect = 6e-22 Identities = 53/74 (71%), Positives = 63/74 (85%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFKDED+I +DTE+TAF+NGQLPQQKL+FR+L+ S Sbjct: 900 GARPVKRVIQQNVENELAKGILRGEFKDEDSILVDTELTAFANGQLPQQKLIFRRLDRDS 959 Query: 172 DLSSENRGAAFSQT 131 + + + A SQT Sbjct: 960 ETQATDSEEALSQT 973 >ref|XP_003543903.1| PREDICTED: chaperone protein ClpB3, chloroplastic [Glycine max] Length = 978 Score = 107 bits (268), Expect = 1e-21 Identities = 53/73 (72%), Positives = 62/73 (84%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFK+ED I +DTEVT F+NGQLPQQKLVFR++E+ S Sbjct: 904 GARPVKRVIQQNVENELAKGILRGEFKEEDTILVDTEVTVFANGQLPQQKLVFRRVEADS 963 Query: 172 DLSSENRGAAFSQ 134 + + E+R F Q Sbjct: 964 NSTVEDRREGFPQ 976 >ref|XP_004304250.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 983 Score = 107 bits (267), Expect = 2e-21 Identities = 53/70 (75%), Positives = 63/70 (90%), Gaps = 1/70 (1%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQYVENELAKGILRGEF++E I +DTEVTA+ NGQLPQQKLVF+ LE+GS Sbjct: 909 GARPVKRVIQQYVENELAKGILRGEFQEEGTILVDTEVTAYGNGQLPQQKLVFKTLETGS 968 Query: 172 DL-SSENRGA 146 + ++EN+GA Sbjct: 969 ESPAAENKGA 978 >gb|EMJ16121.1| hypothetical protein PRUPE_ppa000855mg [Prunus persica] Length = 981 Score = 107 bits (266), Expect = 2e-21 Identities = 54/75 (72%), Positives = 64/75 (85%), Gaps = 1/75 (1%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLES-G 176 GARPVKRVIQQYVENELAKGILRG+F +ED +FIDTEVTAFSNGQLPQQKL+F++LE+ Sbjct: 906 GARPVKRVIQQYVENELAKGILRGDFGEEDTVFIDTEVTAFSNGQLPQQKLLFKRLETDD 965 Query: 175 SDLSSENRGAAFSQT 131 S+ + AFS+T Sbjct: 966 SESPAAENQEAFSET 980 >ref|XP_002305376.1| hypothetical protein POPTR_0004s12360g [Populus trichocarpa] gi|222848340|gb|EEE85887.1| hypothetical protein POPTR_0004s12360g [Populus trichocarpa] Length = 967 Score = 105 bits (263), Expect = 5e-21 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 1/75 (1%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ+VENELAKGILRGE KDED++ IDT+VTAF+NG LPQQKLVF++LE+ Sbjct: 894 GARPVKRVIQQHVENELAKGILRGELKDEDSVAIDTQVTAFANGHLPQQKLVFKRLETSE 953 Query: 172 D-LSSENRGAAFSQT 131 D ++E+R AFSQT Sbjct: 954 DKAAAESR--AFSQT 966 >gb|AAN17424.1| HSP100/ClpB, putative [Arabidopsis thaliana] gi|27311927|gb|AAO00929.1| HSP100/ClpB, putative [Arabidopsis thaliana] Length = 173 Score = 105 bits (262), Expect = 6e-21 Identities = 54/73 (73%), Positives = 61/73 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ +ENELAKGILRG+FK+ED I IDTEVTAFSNGQLPQQKL F+K+ES Sbjct: 102 GARPVKRVIQQNIENELAKGILRGDFKEEDGILIDTEVTAFSNGQLPQQKLTFKKIES-E 160 Query: 172 DLSSENRGAAFSQ 134 +E AAFS+ Sbjct: 161 TADAEQEEAAFSK 173 >ref|XP_003554908.1| PREDICTED: chaperone protein ClpB3, chloroplastic-like isoform X1 [Glycine max] Length = 978 Score = 105 bits (262), Expect = 6e-21 Identities = 51/73 (69%), Positives = 61/73 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ VENELAKGILRGEFK+ED I +DTEVT +NGQ+PQQKLVFR++E+ S Sbjct: 904 GARPVKRVIQQNVENELAKGILRGEFKEEDTILVDTEVTVLANGQIPQQKLVFRRVEADS 963 Query: 172 DLSSENRGAAFSQ 134 ++E+R F Q Sbjct: 964 SSAAEDRREGFPQ 976 >ref|NP_568314.1| chaperone protein ClpB3 [Arabidopsis thaliana] gi|75174044|sp|Q9LF37.1|CLPB3_ARATH RecName: Full=Chaperone protein ClpB3, chloroplastic; AltName: Full=ATP-dependent Clp protease ATP-binding subunit ClpB homolog 3; AltName: Full=Casein lytic proteinase B3; AltName: Full=Protein ALBINO OR PALE GREEN 6; Flags: Precursor gi|9755800|emb|CAC01744.1| clpB heat shock protein-like [Arabidopsis thaliana] gi|332004779|gb|AED92162.1| casein lytic proteinase B3 [Arabidopsis thaliana] Length = 968 Score = 105 bits (262), Expect = 6e-21 Identities = 54/73 (73%), Positives = 61/73 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ +ENELAKGILRG+FK+ED I IDTEVTAFSNGQLPQQKL F+K+ES Sbjct: 897 GARPVKRVIQQNIENELAKGILRGDFKEEDGILIDTEVTAFSNGQLPQQKLTFKKIES-E 955 Query: 172 DLSSENRGAAFSQ 134 +E AAFS+ Sbjct: 956 TADAEQEEAAFSK 968 >ref|XP_002873724.1| APG6/CLPB-P/CLPB3 [Arabidopsis lyrata subsp. lyrata] gi|297319561|gb|EFH49983.1| APG6/CLPB-P/CLPB3 [Arabidopsis lyrata subsp. lyrata] Length = 972 Score = 105 bits (261), Expect = 8e-21 Identities = 52/73 (71%), Positives = 61/73 (83%) Frame = -3 Query: 352 GARPVKRVIQQYVENELAKGILRGEFKDEDNIFIDTEVTAFSNGQLPQQKLVFRKLESGS 173 GARPVKRVIQQ +ENELAKGILRG+FK+ED I IDTEVTAFSNGQLPQQKL F+K+ES + Sbjct: 897 GARPVKRVIQQNIENELAKGILRGDFKEEDGILIDTEVTAFSNGQLPQQKLTFKKIESET 956 Query: 172 DLSSENRGAAFSQ 134 + + AFS+ Sbjct: 957 ADAEQEEEEAFSK 969