BLASTX nr result
ID: Rehmannia24_contig00007977
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00007977 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY11339.1| Chaperone DnaJ-domain superfamily protein [Theobr... 57 3e-06 >gb|EOY11339.1| Chaperone DnaJ-domain superfamily protein [Theobroma cacao] Length = 293 Score = 57.0 bits (136), Expect = 3e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +3 Query: 246 MCRECMDPFDQPEYEAYDIFVNGVLCIGRG 335 +CREC+DPFD PE EA+D+FVN VLC+G+G Sbjct: 154 LCRECLDPFDSPECEAFDVFVNEVLCVGKG 183