BLASTX nr result
ID: Rehmannia24_contig00007499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00007499 (503 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlise... 62 6e-08 >gb|EPS67073.1| hypothetical protein M569_07705, partial [Genlisea aurea] Length = 355 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +2 Query: 290 MEPVLGSEIDCS--VRPEPESGPECPARTESSGSDLVDHSYVPRIRPSEANGFAVYTRNK 463 M+P LGSEI+CS + E P+ PAR SD +D Y R+R SEA GFAVYTR K Sbjct: 1 MKPELGSEIECSGPSKGSDEQQPD-PARDNLDDSDWLDRCYTSRVRESEAKGFAVYTRKK 59 Query: 464 RLKS 475 RLKS Sbjct: 60 RLKS 63