BLASTX nr result
ID: Rehmannia24_contig00007072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00007072 (1094 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS70603.1| hypothetical protein M569_04157, partial [Genlise... 74 1e-10 ref|XP_002318843.1| hypothetical protein POPTR_0012s13800g [Popu... 69 3e-09 ref|XP_004513686.1| PREDICTED: zinc finger CCCH domain-containin... 69 4e-09 gb|ESW24345.1| hypothetical protein PHAVU_004G122600g [Phaseolus... 67 2e-08 ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Popu... 66 2e-08 ref|XP_003534022.1| PREDICTED: zinc finger CCCH domain-containin... 66 3e-08 gb|EXC11889.1| Zinc finger CCCH domain-containing protein 48 [Mo... 65 5e-08 ref|XP_004308123.1| PREDICTED: zinc finger CCCH domain-containin... 65 5e-08 gb|EMJ19231.1| hypothetical protein PRUPE_ppa006002mg [Prunus pe... 65 5e-08 ref|XP_004141129.1| PREDICTED: zinc finger CCCH domain-containin... 65 6e-08 ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containin... 65 6e-08 ref|XP_006490309.1| PREDICTED: zinc finger CCCH domain-containin... 64 8e-08 ref|XP_006421832.1| hypothetical protein CICLE_v10005002mg [Citr... 64 8e-08 ref|XP_004953439.1| PREDICTED: zinc finger CCCH domain-containin... 64 8e-08 gb|AFW72792.1| hypothetical protein ZEAMMB73_250148 [Zea mays] 64 8e-08 ref|XP_002454483.1| hypothetical protein SORBIDRAFT_04g031930 [S... 64 8e-08 ref|NP_001131242.1| uncharacterized protein LOC100192554 [Zea ma... 64 8e-08 ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ric... 64 1e-07 ref|XP_006857936.1| hypothetical protein AMTR_s00069p00156070 [A... 63 2e-07 gb|EOY23072.1| Zinc finger WD40 repeat protein 1 isoform 1 [Theo... 63 2e-07 >gb|EPS70603.1| hypothetical protein M569_04157, partial [Genlisea aurea] Length = 440 Score = 73.6 bits (179), Expect = 1e-10 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + I+VWSLETLQ +QTL GH DVVMSVLCWD FLLSASLDK+ K Sbjct: 290 HSIRVWSLETLQCVQTLSGHTDVVMSVLCWDQFLLSASLDKTVK 333 >ref|XP_002318843.1| hypothetical protein POPTR_0012s13800g [Populus trichocarpa] gi|222859516|gb|EEE97063.1| hypothetical protein POPTR_0012s13800g [Populus trichocarpa] Length = 452 Score = 68.9 bits (167), Expect = 3e-09 Identities = 36/73 (49%), Positives = 47/73 (64%), Gaps = 7/73 (9%) Frame = +3 Query: 846 EQAITLKEHKLVRIDKGLKPRT-------YRIKVWSLETLQYIQTLRGHKDVVMSVLCWD 1004 E A++LK+HK+ + + + IKVWSLETLQ IQTL H VVMS+LCW+ Sbjct: 281 EPAVSLKDHKMAVVSLVVGANRLYSGSMDHSIKVWSLETLQCIQTLTDHTSVVMSLLCWE 340 Query: 1005 HFLLSASLDKSCK 1043 FLLS SLD++ K Sbjct: 341 QFLLSCSLDQTIK 353 >ref|XP_004513686.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cicer arietinum] Length = 437 Score = 68.6 bits (166), Expect = 4e-09 Identities = 32/42 (76%), Positives = 35/42 (83%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 I+VW+LETLQ IQTL GH VVMSVLCWD FLLS SLDK+ K Sbjct: 295 IRVWNLETLQCIQTLTGHTSVVMSVLCWDQFLLSCSLDKTVK 336 >gb|ESW24345.1| hypothetical protein PHAVU_004G122600g [Phaseolus vulgaris] Length = 424 Score = 66.6 bits (161), Expect = 2e-08 Identities = 32/42 (76%), Positives = 34/42 (80%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 IKVW+LETLQ IQTL H VVMSVLCWD FLLS SLDK+ K Sbjct: 283 IKVWNLETLQCIQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 324 >ref|XP_002321881.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] gi|550322663|gb|EEF06008.2| hypothetical protein POPTR_0015s13760g [Populus trichocarpa] Length = 454 Score = 66.2 bits (160), Expect = 2e-08 Identities = 34/73 (46%), Positives = 46/73 (63%), Gaps = 7/73 (9%) Frame = +3 Query: 846 EQAITLKEHKLVRIDKGLKPRT-------YRIKVWSLETLQYIQTLRGHKDVVMSVLCWD 1004 E A +L +HK+ + + + IKVWSLETLQ +QTL+ H VVMS+LCW+ Sbjct: 283 EPAASLNDHKMAVVSLVVGANRLYSGSMDHSIKVWSLETLQCVQTLKDHTSVVMSLLCWE 342 Query: 1005 HFLLSASLDKSCK 1043 FLLS SLD++ K Sbjct: 343 QFLLSCSLDQTIK 355 >ref|XP_003534022.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Glycine max] Length = 426 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 IKVW+LETLQ +QTL H VVMSVLCWD FLLS SLDK+ K Sbjct: 285 IKVWNLETLQCLQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 326 >gb|EXC11889.1| Zinc finger CCCH domain-containing protein 48 [Morus notabilis] Length = 456 Score = 65.1 bits (157), Expect = 5e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + IKVWSLETLQ +QTL H VVMS+LCW+ FLLS SLDK+ K Sbjct: 290 HSIKVWSLETLQCLQTLTDHSSVVMSLLCWNQFLLSCSLDKTIK 333 >ref|XP_004308123.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Fragaria vesca subsp. vesca] Length = 439 Score = 65.1 bits (157), Expect = 5e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + I+VWSLE LQ IQTL H VVMSVLCWD FLLS+SLDK K Sbjct: 297 HSIRVWSLENLQCIQTLTEHTSVVMSVLCWDQFLLSSSLDKKLK 340 >gb|EMJ19231.1| hypothetical protein PRUPE_ppa006002mg [Prunus persica] Length = 433 Score = 65.1 bits (157), Expect = 5e-08 Identities = 31/44 (70%), Positives = 34/44 (77%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + I+VWSLETLQ IQTL H VVMSVLCWD FLLS SLD+ K Sbjct: 291 HSIRVWSLETLQCIQTLTEHTSVVMSVLCWDQFLLSCSLDQQLK 334 >ref|XP_004141129.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cucumis sativus] gi|449521989|ref|XP_004168011.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Cucumis sativus] Length = 432 Score = 64.7 bits (156), Expect = 6e-08 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + IKVWSLE+LQ +QTL H VVMSVLCW+ FLLS SLDK+ K Sbjct: 288 HTIKVWSLESLQCLQTLTDHTSVVMSVLCWEQFLLSCSLDKTIK 331 >ref|XP_003548225.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Glycine max] Length = 427 Score = 64.7 bits (156), Expect = 6e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 I+VW+LETLQ +QTL H VVMSVLCWD FLLS SLDK+ K Sbjct: 286 IRVWNLETLQCLQTLTEHTSVVMSVLCWDQFLLSCSLDKTVK 327 >ref|XP_006490309.1| PREDICTED: zinc finger CCCH domain-containing protein 48-like [Citrus sinensis] Length = 434 Score = 64.3 bits (155), Expect = 8e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 I+VW+LETLQ IQTL H VVMS+LCWD FLLS SLDK+ K Sbjct: 295 IRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIK 336 >ref|XP_006421832.1| hypothetical protein CICLE_v10005002mg [Citrus clementina] gi|557523705|gb|ESR35072.1| hypothetical protein CICLE_v10005002mg [Citrus clementina] Length = 434 Score = 64.3 bits (155), Expect = 8e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 918 IKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 I+VW+LETLQ IQTL H VVMS+LCWD FLLS SLDK+ K Sbjct: 295 IRVWNLETLQCIQTLTEHTSVVMSLLCWDQFLLSCSLDKTIK 336 >ref|XP_004953439.1| PREDICTED: zinc finger CCCH domain-containing protein 17-like [Setaria italica] Length = 428 Score = 64.3 bits (155), Expect = 8e-08 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +3 Query: 846 EQAITLKEHKL---------VRIDKGLKPRTYRIKVWSLETLQYIQTLRGHKDVVMSVLC 998 E A +L HKL +R+ +T I+VW L TLQ IQTL H DVVMSVLC Sbjct: 259 EPAASLDGHKLAVVSLIVGGMRLYSASMDKT--IRVWDLATLQCIQTLSDHTDVVMSVLC 316 Query: 999 WDHFLLSASLDKSCK 1043 WD FLLS SLD++ K Sbjct: 317 WDQFLLSCSLDQTIK 331 >gb|AFW72792.1| hypothetical protein ZEAMMB73_250148 [Zea mays] Length = 350 Score = 64.3 bits (155), Expect = 8e-08 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +3 Query: 846 EQAITLKEHKL---------VRIDKGLKPRTYRIKVWSLETLQYIQTLRGHKDVVMSVLC 998 E A +L HKL +R+ +T I+VW L TLQ IQTL H DVVMSVLC Sbjct: 258 EPAASLDGHKLAVVSLIVGGMRLYSASMDKT--IRVWDLATLQCIQTLSDHTDVVMSVLC 315 Query: 999 WDHFLLSASLDKSCK 1043 WD FLLS SLD++ K Sbjct: 316 WDQFLLSCSLDQTIK 330 >ref|XP_002454483.1| hypothetical protein SORBIDRAFT_04g031930 [Sorghum bicolor] gi|241934314|gb|EES07459.1| hypothetical protein SORBIDRAFT_04g031930 [Sorghum bicolor] Length = 429 Score = 64.3 bits (155), Expect = 8e-08 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +3 Query: 846 EQAITLKEHKL---------VRIDKGLKPRTYRIKVWSLETLQYIQTLRGHKDVVMSVLC 998 E A +L HKL +R+ +T I+VW L TLQ IQTL H DVVMSVLC Sbjct: 260 EPAASLDGHKLAVVSLIVGGMRLYSASMDKT--IRVWDLATLQCIQTLSDHTDVVMSVLC 317 Query: 999 WDHFLLSASLDKSCK 1043 WD FLLS SLD++ K Sbjct: 318 WDQFLLSCSLDQTIK 332 >ref|NP_001131242.1| uncharacterized protein LOC100192554 [Zea mays] gi|194690974|gb|ACF79571.1| unknown [Zea mays] gi|195649475|gb|ACG44205.1| nucleic acid binding protein [Zea mays] gi|407232732|gb|AFT82708.1| C3H34 C3H type transcription factor, partial [Zea mays subsp. mays] gi|413938240|gb|AFW72791.1| nucleic acid binding protein [Zea mays] Length = 427 Score = 64.3 bits (155), Expect = 8e-08 Identities = 38/75 (50%), Positives = 45/75 (60%), Gaps = 9/75 (12%) Frame = +3 Query: 846 EQAITLKEHKL---------VRIDKGLKPRTYRIKVWSLETLQYIQTLRGHKDVVMSVLC 998 E A +L HKL +R+ +T I+VW L TLQ IQTL H DVVMSVLC Sbjct: 258 EPAASLDGHKLAVVSLIVGGMRLYSASMDKT--IRVWDLATLQCIQTLSDHTDVVMSVLC 315 Query: 999 WDHFLLSASLDKSCK 1043 WD FLLS SLD++ K Sbjct: 316 WDQFLLSCSLDQTIK 330 >ref|XP_002510854.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223549969|gb|EEF51456.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 445 Score = 63.9 bits (154), Expect = 1e-07 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +3 Query: 912 YRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 + I+VW+LETLQ +QTL H VVMSVLCWD FLLS SLD+ K Sbjct: 303 HSIRVWNLETLQCVQTLTDHTSVVMSVLCWDQFLLSCSLDQKIK 346 >ref|XP_006857936.1| hypothetical protein AMTR_s00069p00156070 [Amborella trichopoda] gi|548862038|gb|ERN19403.1| hypothetical protein AMTR_s00069p00156070 [Amborella trichopoda] Length = 424 Score = 63.2 bits (152), Expect = 2e-07 Identities = 33/56 (58%), Positives = 38/56 (67%) Frame = +3 Query: 876 LVRIDKGLKPRTYRIKVWSLETLQYIQTLRGHKDVVMSVLCWDHFLLSASLDKSCK 1043 L RI G T IKVW L+TLQ +QTL H VVMS+LCWD FLLS SLD++ K Sbjct: 277 LKRIYSGSMDNT--IKVWDLDTLQCLQTLSEHSSVVMSLLCWDQFLLSCSLDRTIK 330 >gb|EOY23072.1| Zinc finger WD40 repeat protein 1 isoform 1 [Theobroma cacao] Length = 447 Score = 63.2 bits (152), Expect = 2e-07 Identities = 34/73 (46%), Positives = 45/73 (61%), Gaps = 7/73 (9%) Frame = +3 Query: 846 EQAITLKEHKLVRIDKGLKPRT-------YRIKVWSLETLQYIQTLRGHKDVVMSVLCWD 1004 E A +LK H L + + + I+VWSLETLQ +QTL H +VVMS+LCW+ Sbjct: 260 EAAASLKSHTLAVVSLVVGANRLYSGSMDHSIRVWSLETLQCLQTLTEHHNVVMSLLCWE 319 Query: 1005 HFLLSASLDKSCK 1043 FLLS SLD++ K Sbjct: 320 QFLLSCSLDQTIK 332