BLASTX nr result
ID: Rehmannia24_contig00006973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006973 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59376.1| hypothetical protein M569_15432, partial [Genlise... 86 5e-15 gb|EPS60989.1| hypothetical protein M569_13812 [Genlisea aurea] 77 2e-12 ref|XP_006359297.1| PREDICTED: transcription factor TCP7-like is... 60 4e-07 ref|XP_006359296.1| PREDICTED: transcription factor TCP7-like is... 60 4e-07 ref|NP_001234581.1| TCP transcription factor 14 [Solanum lycoper... 60 4e-07 >gb|EPS59376.1| hypothetical protein M569_15432, partial [Genlisea aurea] Length = 168 Score = 85.9 bits (211), Expect = 5e-15 Identities = 46/52 (88%), Positives = 48/52 (92%), Gaps = 2/52 (3%) Frame = +1 Query: 1 RFLQ-QQQPLGIGEASAARVGNYLPI-AQVQGHHLNLLASLSSPHPQSAEQR 150 RFLQ QQQPLG+GEASAARVGNYLPI AQVQGHHLNLLASLS P PQS+EQR Sbjct: 117 RFLQHQQQPLGLGEASAARVGNYLPIAAQVQGHHLNLLASLSGPPPQSSEQR 168 >gb|EPS60989.1| hypothetical protein M569_13812 [Genlisea aurea] Length = 294 Score = 77.4 bits (189), Expect = 2e-12 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 3/59 (5%) Frame = +1 Query: 1 RFLQQQQP-LGIGEASAARVGNYLPIAQVQGHHLNLLASLSS--PHPQSAEQRRDDDTN 168 RFLQQQQP L +GEASAAR GNYLPIAQV GHHLNLLAS SS P PQ +E++R+ D + Sbjct: 191 RFLQQQQPHLELGEASAARAGNYLPIAQVHGHHLNLLASQSSGAPPPQLSERQREADAD 249 >ref|XP_006359297.1| PREDICTED: transcription factor TCP7-like isoform X2 [Solanum tuberosum] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +1 Query: 1 RFLQQQQPLGIGEASAARVGNYLPIAQVQGHHLNLLASLSSPHPQSAEQRRDDD 162 RF QQQ +GEASAARVGNYLP+ Q HLNLLASLS P PQ + RRDDD Sbjct: 218 RFFQQQ----MGEASAARVGNYLPMTQ---GHLNLLASLSGP-PQPSSGRRDDD 263 >ref|XP_006359296.1| PREDICTED: transcription factor TCP7-like isoform X1 [Solanum tuberosum] Length = 265 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +1 Query: 1 RFLQQQQPLGIGEASAARVGNYLPIAQVQGHHLNLLASLSSPHPQSAEQRRDDD 162 RF QQQ +GEASAARVGNYLP+ Q HLNLLASLS P PQ + RRDDD Sbjct: 218 RFFQQQ----MGEASAARVGNYLPMTQ---GHLNLLASLSGP-PQPSSGRRDDD 263 >ref|NP_001234581.1| TCP transcription factor 14 [Solanum lycopersicum] gi|306416839|gb|ADM87263.1| TCP transcription factor 14 [Solanum lycopersicum] Length = 266 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/54 (66%), Positives = 39/54 (72%) Frame = +1 Query: 1 RFLQQQQPLGIGEASAARVGNYLPIAQVQGHHLNLLASLSSPHPQSAEQRRDDD 162 RF QQQ +GEASAARVGNYLP+ Q HLNLLASLS P PQ + RRDDD Sbjct: 219 RFFQQQ----MGEASAARVGNYLPMTQ---GHLNLLASLSGP-PQPSSGRRDDD 264