BLASTX nr result
ID: Rehmannia24_contig00006971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006971 (335 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006366171.1| PREDICTED: BAG family molecular chaperone re... 73 4e-11 gb|EPS71684.1| hypothetical protein M569_03076 [Genlisea aurea] 63 4e-08 ref|XP_004234927.1| PREDICTED: BAG family molecular chaperone re... 62 8e-08 >ref|XP_006366171.1| PREDICTED: BAG family molecular chaperone regulator 7-like [Solanum tuberosum] Length = 403 Score = 72.8 bits (177), Expect = 4e-11 Identities = 45/78 (57%), Positives = 53/78 (67%), Gaps = 3/78 (3%) Frame = -1 Query: 227 MSRFRRFEIVEHSPSYILKQTSVFKPLRTLMLNPCFPSFPIVEDELDYTLDLLSFTPTPP 48 MSRFRRF+++++SPS S F P +TL+LNP PSF EDELD TLDL+ P P Sbjct: 1 MSRFRRFDLIDYSPS-----PSFFTP-KTLLLNPYLPSFHN-EDELDCTLDLICPKPYVP 53 Query: 47 ALF---DDFDTITDLIQI 3 F DDFDTITDLIQI Sbjct: 54 TTFLDLDDFDTITDLIQI 71 >gb|EPS71684.1| hypothetical protein M569_03076 [Genlisea aurea] Length = 400 Score = 63.2 bits (152), Expect = 4e-08 Identities = 35/76 (46%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = -1 Query: 227 MSRFRRFEIVEHSPSYILKQTSVFK-PLRTLMLNPCFPSFPIVEDELDYTLDLLSFTPTP 51 MSR RRFE+VEH P Y ++S+F P ++ +P FP I EDEL L F+ T Sbjct: 1 MSRIRRFEVVEHFPRY---ESSIFPFPNAAVLGDPFFPPHSIFEDELHQALGFPRFSKTR 57 Query: 50 PALFDDFDTITDLIQI 3 P F+DF+ + DLIQI Sbjct: 58 PFSFEDFEAVIDLIQI 73 >ref|XP_004234927.1| PREDICTED: BAG family molecular chaperone regulator 7-like [Solanum lycopersicum] Length = 395 Score = 62.0 bits (149), Expect = 8e-08 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 3/78 (3%) Frame = -1 Query: 227 MSRFRRFEIVEHSPSYILKQTSVFKPLRTLMLNPCFPSFPIVEDELDYTLDLLSFTPTPP 48 MSRFRRF+I+++S S S F P +TL+LNP F +EDELD TLDL+ P P Sbjct: 1 MSRFRRFDIIDYSSS-----PSFFTP-KTLLLNPYFH----IEDELDCTLDLICPKPYAP 50 Query: 47 ALF---DDFDTITDLIQI 3 F ++FD+ITDLIQI Sbjct: 51 NTFLDLENFDSITDLIQI 68