BLASTX nr result
ID: Rehmannia24_contig00006908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006908 (708 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29183.1| Receptor-like protein 12 [Morus notabilis] 59 2e-06 ref|XP_002510786.1| serine-threonine protein kinase, plant-type,... 57 8e-06 >gb|EXB29183.1| Receptor-like protein 12 [Morus notabilis] Length = 702 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = -3 Query: 706 HFAHLSNLTALMASGNQMTLKVSPYWIPPFKLHRLRLGSWNFG 578 HF +L+ L+A ASGN + L+VSP WIPPF L L +GSWN G Sbjct: 166 HFVNLTRLSAFSASGNSLILRVSPDWIPPFHLRLLLMGSWNLG 208 >ref|XP_002510786.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223549901|gb|EEF51388.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 1054 Score = 56.6 bits (135), Expect = 8e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 706 HFAHLSNLTALMASGNQMTLKVSPYWIPPFKLHRLRLGSWNFG 578 HF +L++LTA +AS N + LKVSP W+PPF+L L L WN G Sbjct: 496 HFTNLTSLTAFVASHNHLVLKVSPAWVPPFRLKELGLRYWNLG 538