BLASTX nr result
ID: Rehmannia24_contig00006823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006823 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523493.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_006473971.1| PREDICTED: transcription factor bHLH66-like ... 55 1e-05 ref|XP_006453668.1| hypothetical protein CICLE_v10008192mg [Citr... 55 1e-05 >ref|XP_002523493.1| conserved hypothetical protein [Ricinus communis] gi|223537200|gb|EEF38832.1| conserved hypothetical protein [Ricinus communis] Length = 474 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -3 Query: 224 GPTSPSMSVLTNQSATIGGNGGGEPSLKDAASVSKP 117 GP+SPSMSVLT QSAT+ GNGG +PS+KDAASVSKP Sbjct: 440 GPSSPSMSVLTVQSATL-GNGGLDPSVKDAASVSKP 474 >ref|XP_006473971.1| PREDICTED: transcription factor bHLH66-like [Citrus sinensis] Length = 469 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 224 GPTSPSMSVLTNQSATIGGNGGGEPSLKDAASVSKP 117 GPTSPSMSVLT QSAT+ GNGG + S+KDAASVSKP Sbjct: 435 GPTSPSMSVLTVQSATM-GNGGADGSVKDAASVSKP 469 >ref|XP_006453668.1| hypothetical protein CICLE_v10008192mg [Citrus clementina] gi|557556894|gb|ESR66908.1| hypothetical protein CICLE_v10008192mg [Citrus clementina] Length = 469 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 224 GPTSPSMSVLTNQSATIGGNGGGEPSLKDAASVSKP 117 GPTSPSMSVLT QSAT+ GNGG + S+KDAASVSKP Sbjct: 435 GPTSPSMSVLTVQSATM-GNGGADGSVKDAASVSKP 469