BLASTX nr result
ID: Rehmannia24_contig00006567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006567 (427 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64848.1| hypothetical protein [Beta vulgaris] 55 7e-06 >dbj|BAM64848.1| hypothetical protein [Beta vulgaris] Length = 103 Score = 55.5 bits (132), Expect = 7e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 197 CSQLGELEAEAVDHAREYRAHIMVLMEQLSGAKELLQ 87 CSQLGELEAEAVD AR++RA ++ LME+LS A++LLQ Sbjct: 56 CSQLGELEAEAVDQARDFRARMLALMEELSKAQKLLQ 92