BLASTX nr result
ID: Rehmannia24_contig00006346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006346 (363 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, part... 83 4e-14 ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arab... 82 1e-13 ref|XP_006340116.1| PREDICTED: spermidine synthase 1-like [Solan... 79 8e-13 sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synthase 2; Shor... 78 1e-12 sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synthase 1; Shor... 78 1e-12 gb|AGW82430.1| spermidine synthase [Camellia sinensis] 78 1e-12 ref|XP_004237263.1| PREDICTED: spermidine synthase 1-like [Solan... 77 2e-12 gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] 77 3e-12 gb|ACZ73829.1| spermidine synthase [Olea europaea] 75 7e-12 ref|XP_006416052.1| hypothetical protein EUTSA_v10007822mg [Eutr... 74 2e-11 gb|ABK81124.1| spermidine synthase [Nicotiana tabacum] 74 2e-11 sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synthase 1; Shor... 74 2e-11 ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citr... 74 2e-11 pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From ... 74 2e-11 ref|XP_002890597.1| hypothetical protein ARALYDRAFT_889925 [Arab... 74 2e-11 ref|NP_173794.2| spermidine synthase 1 [Arabidopsis thaliana] gi... 74 2e-11 emb|CAO02391.1| spermidine synthase [Cochlearia officinalis] 73 4e-11 sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synthase; Short=... 72 6e-11 ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis thaliana] gi... 72 8e-11 gb|EOY00385.1| Spermidine synthase 1 [Theobroma cacao] 72 8e-11 >ref|XP_006302420.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] gi|482571130|gb|EOA35318.1| hypothetical protein CARUB_v10020501mg, partial [Capsella rubella] Length = 368 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPIDADES IKS GPL+FYNAEIHSAAFCLPSFA+KVI+SKAN Sbjct: 324 VNPIDADESSIKSHGPLRFYNAEIHSAAFCLPSFAKKVIDSKAN 367 >ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] gi|297334608|gb|EFH65026.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPIDADES KS GPLKFYNAEIHSAAFCLPSFA+KVI+SKAN Sbjct: 297 VNPIDADESSSKSHGPLKFYNAEIHSAAFCLPSFAKKVIDSKAN 340 >ref|XP_006340116.1| PREDICTED: spermidine synthase 1-like [Solanum tuberosum] Length = 309 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/42 (80%), Positives = 41/42 (97%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESK 238 INPIDAD+SH K++GPLKFYN+EIHSA+FCLPSFA++VIESK Sbjct: 266 INPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESK 307 >sp|O48659.1|SPD2_HYONI RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|2821957|dbj|BAA24534.1| spermidine synthase 2 [Hyoscyamus niger] Length = 308 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKA 235 INPIDAD+SH K++GPLKFYN+EIHSA+FCLPSFA++VIES A Sbjct: 265 INPIDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESNA 307 >sp|Q96556.1|SPD1_DATST RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi|1561577|emb|CAA69420.1| spermidine synthase 1 [Datura stramonium] Length = 308 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESK 238 INP+DAD+SH K++GPLKFYN+EIHSA+FCLPSFA++VIESK Sbjct: 265 INPVDADDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESK 306 >gb|AGW82430.1| spermidine synthase [Camellia sinensis] Length = 329 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKA 235 +NPIDAD+SH KSKGPLKFYN+EIH+A+FCLPSFA+KVI+S A Sbjct: 286 VNPIDADDSHCKSKGPLKFYNSEIHAASFCLPSFAKKVIDSIA 328 >ref|XP_004237263.1| PREDICTED: spermidine synthase 1-like [Solanum lycopersicum] Length = 309 Score = 77.0 bits (188), Expect = 2e-12 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESK 238 INPID D+SH K++GPLKFYN+EIHSA+FCLPSFA++VIESK Sbjct: 266 INPIDVDDSHTKTRGPLKFYNSEIHSASFCLPSFAKRVIESK 307 >gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] Length = 165 Score = 76.6 bits (187), Expect = 3e-12 Identities = 32/42 (76%), Positives = 40/42 (95%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESK 238 +NPIDAD +H KS+GPLKFYN+EIHSAAFCLP+FA+KV++SK Sbjct: 124 VNPIDADNNHSKSRGPLKFYNSEIHSAAFCLPTFAKKVVDSK 165 >gb|ACZ73829.1| spermidine synthase [Olea europaea] Length = 337 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 INPIDAD SH+ +K PLKFYN+E+HSAAFCLP FA++VIESKAN Sbjct: 294 INPIDADCSHVNTKRPLKFYNSEMHSAAFCLPLFAKRVIESKAN 337 >ref|XP_006416052.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] gi|557093823|gb|ESQ34405.1| hypothetical protein EUTSA_v10007822mg [Eutrema salsugineum] Length = 397 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPID ES KS GPLKFYNAEIHSAAFCLPSFA+KVIESKAN Sbjct: 356 VNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKAN 397 >gb|ABK81124.1| spermidine synthase [Nicotiana tabacum] Length = 174 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/44 (72%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 INPIDAD SH K+ GP+KFYN+E+H A+FCLPSFA++VIESK N Sbjct: 109 INPIDADASHNKTLGPMKFYNSELHKASFCLPSFAKRVIESKGN 152 >sp|Q9ZUB3.1|SPD1_ARATH RecName: Full=Spermidine synthase 1; Short=SPDSY 1; AltName: Full=Putrescine aminopropyltransferase 1 gi|4056467|gb|AAC98040.1| Strong similarity to gb|AB006693 spermidine synthase from Arabidopsis thaliana. ESTs gb|AA389822, gb|T41794, gb|N38455, gb|AI100106, gb|F14442 and gb|F14256 come from this gene [Arabidopsis thaliana] gi|6468489|emb|CAB61614.1| spermidine synthase 1 [Arabidopsis thaliana] gi|6682289|emb|CAB64644.1| spermidine synthase [Arabidopsis thaliana] gi|17065034|gb|AAL32671.1| Strong similarity to spermidine synthase [Arabidopsis thaliana] gi|20260024|gb|AAM13359.1| strong similarity to spermidine synthase [Arabidopsis thaliana] Length = 334 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPID ES KS GPLKFYNAEIHSAAFCLPSFA+KVIESKAN Sbjct: 293 LNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKAN 334 >ref|XP_006438425.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] gi|568860644|ref|XP_006483825.1| PREDICTED: spermidine synthase-like [Citrus sinensis] gi|557540621|gb|ESR51665.1| hypothetical protein CICLE_v10031988mg [Citrus clementina] Length = 345 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 40/43 (93%), Gaps = 1/43 (2%) Frame = -1 Query: 363 INPIDADESHIKS-KGPLKFYNAEIHSAAFCLPSFARKVIESK 238 +NPIDAD+SH S KGPLKFYN+EIH+AAFCLP+FA+KVIESK Sbjct: 299 VNPIDADDSHCNSSKGPLKFYNSEIHTAAFCLPTFAKKVIESK 341 >pdb|1XJ5|A Chain A, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|55670891|pdb|1XJ5|B Chain B, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|55670892|pdb|1XJ5|C Chain C, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|55670893|pdb|1XJ5|D Chain D, X-Ray Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|151568152|pdb|2Q41|A Chain A, Ensemble Refinement Of The Protein Crystal Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|151568155|pdb|2Q41|D Chain D, Ensemble Refinement Of The Protein Crystal Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|343197790|pdb|2Q41|B Chain B, Ensemble Refinement Of The Protein Crystal Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 gi|343197791|pdb|2Q41|C Chain C, Ensemble Refinement Of The Protein Crystal Structure Of Spermidine Synthase From Arabidopsis Thaliana Gene At1g23820 Length = 334 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPID ES KS GPLKFYNAEIHSAAFCLPSFA+KVIESKAN Sbjct: 293 LNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKAN 334 >ref|XP_002890597.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. lyrata] gi|297336439|gb|EFH66856.1| hypothetical protein ARALYDRAFT_889925 [Arabidopsis lyrata subsp. lyrata] Length = 378 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPID ES KS GPLKFYNAEIHSAAFCLPSFA+KVIESKAN Sbjct: 337 LNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKAN 378 >ref|NP_173794.2| spermidine synthase 1 [Arabidopsis thaliana] gi|332192315|gb|AEE30436.1| spermidine synthase 1 [Arabidopsis thaliana] Length = 378 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/44 (84%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 +NPID ES KS GPLKFYNAEIHSAAFCLPSFA+KVIESKAN Sbjct: 337 LNPID--ESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKAN 378 >emb|CAO02391.1| spermidine synthase [Cochlearia officinalis] Length = 328 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/44 (79%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = -1 Query: 360 NPIDA-DESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 NP+++ DES KS GPLKFYNAEIHSAAFCLPSFA+KVIESK+N Sbjct: 285 NPVNSIDESSSKSNGPLKFYNAEIHSAAFCLPSFAKKVIESKSN 328 >sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synthase; Short=SPDSY; AltName: Full=Putrescine aminopropyltransferase gi|3242659|dbj|BAA29033.1| spermidine synthase [Coffea arabica] Length = 316 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 INPIDA++ K+ PLKFYN+EIHSAAFCLPSFA+KVI+SKAN Sbjct: 273 INPIDANDGRSKTMKPLKFYNSEIHSAAFCLPSFAKKVIDSKAN 316 >ref|NP_177188.1| Spermidine synthase 2 [Arabidopsis thaliana] gi|12644069|sp|O48661.2|SPD2_ARATH RecName: Full=Spermidine synthase 2; Short=SPDSY 2; AltName: Full=Putrescine aminopropyltransferase 2 gi|14030637|gb|AAK52993.1|AF375409_1 At1g70310/F17O7_16 [Arabidopsis thaliana] gi|3176685|gb|AAC18808.1| Strong similarity to spermidine synthase 1, gb|Y08252 and possibly closer similarity to spermidine synthase 2 gb|Y08253 from Datura stramonium. ESTs gb|N38155, gb|T41738, gb|AA597626, gb|AA712967 and gb|AA712346 come from this gene [Arabidopsis thaliana] gi|6468491|emb|CAB61615.1| spermidine synthase 2 [Arabidopsis thaliana] gi|56381993|gb|AAV85715.1| At1g70310 [Arabidopsis thaliana] gi|332196923|gb|AEE35044.1| Spermidine synthase 2 [Arabidopsis thaliana] Length = 340 Score = 72.0 bits (175), Expect = 8e-11 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESKAN 232 ++ ID DES IKS PLK+YNAEIHSAAFCLPSFA+KVI+SKAN Sbjct: 297 VSLIDTDESSIKSHCPLKYYNAEIHSAAFCLPSFAKKVIDSKAN 340 >gb|EOY00385.1| Spermidine synthase 1 [Theobroma cacao] Length = 346 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/42 (76%), Positives = 39/42 (92%) Frame = -1 Query: 363 INPIDADESHIKSKGPLKFYNAEIHSAAFCLPSFARKVIESK 238 +NPID+D+S KSK PL+FYN+EIHSAAFCLPSFA+KVI+SK Sbjct: 304 VNPIDSDDSCCKSKRPLRFYNSEIHSAAFCLPSFAKKVIDSK 345