BLASTX nr result
ID: Rehmannia24_contig00006002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00006002 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] 74 2e-11 sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], ... 73 4e-11 ref|XP_004502849.1| PREDICTED: superoxide dismutase [Mn], mitoch... 73 4e-11 gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] 73 4e-11 gb|ABA00455.1| MnSOD [Gossypium hirsutum] 73 4e-11 gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus ... 73 4e-11 gb|AEZ56249.1| manganese superoxide dismutase [Prunus persica] g... 73 4e-11 gb|ACU52584.1| manganese superoxide dismutase [Lantana camara] 73 4e-11 gb|ACU16940.1| unknown [Glycine max] 73 4e-11 gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] 73 4e-11 ref|NP_001235066.1| MnSOD [Glycine max] gi|356516259|ref|XP_0035... 73 4e-11 emb|CAC19487.1| manganese superoxide dismutase 2 [Prunus persica] 73 4e-11 gb|AAC15806.1| superoxide dismutase [Raphanus sativus] 72 6e-11 gb|AFK47652.1| unknown [Medicago truncatula] 72 6e-11 ref|XP_006407489.1| hypothetical protein EUTSA_v10021449mg [Eutr... 72 6e-11 gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] 72 6e-11 gb|ABL75952.1| putative Mn superoxide dismutase [Eutrema halophi... 72 6e-11 gb|AAL07333.1| superoxide dismutase [Raphanus sativus] 72 6e-11 gb|AAN15216.1| manganese superoxide dismutase [Avicennia marina] 72 6e-11 gb|AFS65098.1| manganese superoxide dismutase [Elaeis guineensis] 72 8e-11 >emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] Length = 224 Score = 73.9 bits (180), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASE+YDK Sbjct: 190 AYYLQYKNVRPDYLKNIWKVINWKYASEIYDK 221 >sp|Q9SM64.1|SODM_PRUPE RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|6006619|emb|CAB56851.1| manganese superoxide dismutase 1 [Prunus persica] Length = 228 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 194 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 225 >ref|XP_004502849.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Cicer arietinum] Length = 239 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 205 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 236 >gb|AAC78469.1| manganese superoxide dismutase [Gossypium hirsutum] Length = 198 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 164 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 195 >gb|ABA00455.1| MnSOD [Gossypium hirsutum] Length = 231 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 197 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 228 >gb|AFH08815.1| chloroplast Mn-superoxide dismutase 1C-a [Prunus persica] Length = 237 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 203 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 234 >gb|AEZ56249.1| manganese superoxide dismutase [Prunus persica] gi|383386091|gb|AFH08809.1| chloroplast Mn-superoxide dismutase 1A-a [Prunus persica] gi|383386093|gb|AFH08810.1| chloroplast Mn-superoxide dismutase 1A-b [Prunus persica] gi|383386097|gb|AFH08812.1| chloroplast Mn-superoxide dismutase 1A-d [Prunus persica] gi|383386099|gb|AFH08813.1| chloroplast Mn-superoxide dismutase 1B-a [Prunus persica] gi|383386101|gb|AFH08814.1| chloroplast Mn-superoxide dismutase 1B-b [Prunus persica] gi|383386105|gb|AFH08816.1| chloroplast Mn-superoxide dismutase 1B-c [Prunus persica] gi|383386107|gb|AFH08817.1| chloroplast Mn-superoxide dismutase 1B-d [Prunus persica] gi|462414759|gb|EMJ19496.1| hypothetical protein PRUPE_ppa010748mg [Prunus persica] Length = 237 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 203 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 234 >gb|ACU52584.1| manganese superoxide dismutase [Lantana camara] Length = 224 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDKAL 244 AYYLQYKNVRPDYLKNIWKV+NWKYASEVY+K L Sbjct: 190 AYYLQYKNVRPDYLKNIWKVMNWKYASEVYEKEL 223 >gb|ACU16940.1| unknown [Glycine max] Length = 240 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 206 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 237 >gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] Length = 226 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 192 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 223 >ref|NP_001235066.1| MnSOD [Glycine max] gi|356516259|ref|XP_003526813.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Glycine max] gi|147945633|gb|ABQ52658.1| MnSOD [Glycine max] Length = 241 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 207 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 238 >emb|CAC19487.1| manganese superoxide dismutase 2 [Prunus persica] Length = 80 Score = 72.8 bits (177), Expect = 4e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+K Sbjct: 46 AYYLQYKNVRPDYLKNIWKVINWKYASEVYEK 77 >gb|AAC15806.1| superoxide dismutase [Raphanus sativus] Length = 231 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKN+WKVINWKYASEVY+K Sbjct: 197 AYYLQYKNVRPDYLKNVWKVINWKYASEVYEK 228 >gb|AFK47652.1| unknown [Medicago truncatula] Length = 235 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDKA 247 AYYLQYKNVRPDYLKNIWKVINWKYASEVY+ A Sbjct: 202 AYYLQYKNVRPDYLKNIWKVINWKYASEVYENA 234 >ref|XP_006407489.1| hypothetical protein EUTSA_v10021449mg [Eutrema salsugineum] gi|148515008|gb|ABQ81865.1| Mn superoxide dismutase [Eutrema halophilum] gi|557108635|gb|ESQ48942.1| hypothetical protein EUTSA_v10021449mg [Eutrema salsugineum] Length = 231 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKN+WKVINWKYASEVY+K Sbjct: 197 AYYLQYKNVRPDYLKNVWKVINWKYASEVYEK 228 >gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] Length = 228 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKNIWKVINWKYASE+Y+K Sbjct: 194 AYYLQYKNVRPDYLKNIWKVINWKYASEIYEK 225 >gb|ABL75952.1| putative Mn superoxide dismutase [Eutrema halophilum] Length = 231 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKN+WKVINWKYASEVY+K Sbjct: 197 AYYLQYKNVRPDYLKNVWKVINWKYASEVYEK 228 >gb|AAL07333.1| superoxide dismutase [Raphanus sativus] Length = 231 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDK 250 AYYLQYKNVRPDYLKN+WKVINWKYASEVY+K Sbjct: 197 AYYLQYKNVRPDYLKNVWKVINWKYASEVYEK 228 >gb|AAN15216.1| manganese superoxide dismutase [Avicennia marina] Length = 226 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYD 253 AYYLQYKNVRPDYLKNIWKVINWKYASEVYD Sbjct: 191 AYYLQYKNVRPDYLKNIWKVINWKYASEVYD 221 >gb|AFS65098.1| manganese superoxide dismutase [Elaeis guineensis] Length = 244 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 345 AYYLQYKNVRPDYLKNIWKVINWKYASEVYDKAL 244 AYYLQYKNVRPDYLKNIWKV+NWKYA EVYDK + Sbjct: 210 AYYLQYKNVRPDYLKNIWKVMNWKYAGEVYDKEI 243