BLASTX nr result
ID: Rehmannia24_contig00005770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00005770 (698 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 100 3e-19 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 79 3e-15 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 70 5e-10 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 54 8e-09 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 100 bits (250), Expect = 3e-19 Identities = 50/58 (86%), Positives = 50/58 (86%) Frame = +2 Query: 524 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHL*SALVNRSPPIKQEGSGSSHGG 697 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGEH SALVN SP IKQE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSPSIKQERSGYSHGG 58 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 79.3 bits (194), Expect(2) = 3e-15 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 658 GASIHQRRLQVLSEPCWIVTHHTALKPNLWWIPGDKV 548 GASIHQRRL+VLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 Score = 29.3 bits (64), Expect(2) = 3e-15 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 696 PPWEEPLPSCLMGG 655 PPWEEPL SCL+ G Sbjct: 4 PPWEEPLLSCLIVG 17 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 70.5 bits (171), Expect = 5e-10 Identities = 38/58 (65%), Positives = 38/58 (65%) Frame = +2 Query: 524 MGQRIKRFDFVSRDPPQVGFESRVMGHYPARFGEHL*SALVNRSPPIKQEGSGSSHGG 697 MGQRIKRFDFVSRD PQVGFESRVMG YPARFGE SG SHGG Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE-----------------SGYSHGG 41 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 54.3 bits (129), Expect(2) = 8e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 484 SRDRLSFKPLSFGSDKSSPFGRFAQV 407 +RDRLSFKPLSFGSDKSSPFGRFAQV Sbjct: 9 ARDRLSFKPLSFGSDKSSPFGRFAQV 34 Score = 32.3 bits (72), Expect(2) = 8e-09 Identities = 17/30 (56%), Positives = 22/30 (73%), Gaps = 3/30 (10%) Frame = -3 Query: 414 LRWSS--LIFPNVQRFE-MRKEHRPSAMNE 334 +RWSS + FPNV+ +RKEHRPS +NE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63