BLASTX nr result
ID: Rehmannia24_contig00005541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00005541 (472 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_009970232.1| hypothetical protein [Burkholderia pseudomal... 55 1e-05 >ref|WP_009970232.1| hypothetical protein [Burkholderia pseudomallei] Length = 621 Score = 55.1 bits (131), Expect = 1e-05 Identities = 38/95 (40%), Positives = 48/95 (50%), Gaps = 4/95 (4%) Frame = +3 Query: 186 WLGYKWWWFYHRRFGRVRRLFWDGRRWLGYVWWRFYYRRFGHIRWLFRDGRRWLGYVWWW 365 W G+ W +F R F R W G RW G+ W F R F R+ +R G RW G+ W Sbjct: 390 WRGFGWRYFRRRCF-EWRCFRWRGFRWRGFRWRYFGRRCFRRRRFRWR-GFRWRGFRWRC 447 Query: 366 FYHRWFGR---VRRLFWDSR-RWLGYVRWWFYHRR 458 F R+FGR RR F R RW + RW ++ RR Sbjct: 448 FRWRYFGRRCFRRRCFRRRRFRWRCF-RWRYFGRR 481