BLASTX nr result
ID: Rehmannia24_contig00005428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00005428 (417 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299022.2| hypothetical protein POPTR_0001s46620g [Popu... 75 1e-11 ref|XP_002299023.1| predicted protein [Populus trichocarpa] 75 1e-11 ref|XP_004295435.1| PREDICTED: tetrahydrocannabinolic acid synth... 74 2e-11 ref|XP_004293695.1| PREDICTED: tetrahydrocannabinolic acid synth... 73 4e-11 ref|XP_006352996.1| PREDICTED: cannabidiolic acid synthase-like ... 72 6e-11 ref|XP_002523149.1| Reticuline oxidase precursor, putative [Rici... 72 6e-11 ref|XP_006353077.1| PREDICTED: tetrahydrocannabinolic acid synth... 72 8e-11 ref|XP_002299020.2| hypothetical protein POPTR_0001s46600g [Popu... 72 1e-10 gb|EOY01556.1| FAD-binding Berberine family protein [Theobroma c... 71 1e-10 ref|XP_002317088.2| hypothetical protein POPTR_0011s16190g [Popu... 71 2e-10 emb|CBI22014.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002277294.1| PREDICTED: reticuline oxidase-like protein-l... 71 2e-10 ref|XP_002332196.1| predicted protein [Populus trichocarpa] gi|5... 71 2e-10 emb|CAN63059.1| hypothetical protein VITISV_004192 [Vitis vinifera] 71 2e-10 ref|XP_006353079.1| PREDICTED: cannabidiolic acid synthase-like ... 70 2e-10 gb|EOY25658.1| FAD-binding Berberine family protein [Theobroma c... 70 3e-10 ref|XP_004233882.1| PREDICTED: cannabidiolic acid synthase-like ... 70 3e-10 ref|XP_006353076.1| PREDICTED: tetrahydrocannabinolic acid synth... 70 4e-10 ref|XP_006352995.1| PREDICTED: cannabidiolic acid synthase-like ... 70 4e-10 ref|XP_002299025.2| hypothetical protein POPTR_0001s46650g [Popu... 70 4e-10 >ref|XP_002299022.2| hypothetical protein POPTR_0001s46620g [Populus trichocarpa] gi|550350033|gb|EEE83827.2| hypothetical protein POPTR_0001s46620g [Populus trichocarpa] Length = 533 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLYSYMAPYVS++PR AY NYRDLDLG+NN GNTSYRQA Sbjct: 454 RRLYSYMAPYVSKNPRQAYVNYRDLDLGVNNLGNTSYRQA 493 >ref|XP_002299023.1| predicted protein [Populus trichocarpa] Length = 526 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLYSYMAPYVS++PR AY NYRDLDLG+NN GNTSYRQA Sbjct: 447 RRLYSYMAPYVSKNPRQAYVNYRDLDLGVNNLGNTSYRQA 486 >ref|XP_004295435.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Fragaria vesca subsp. vesca] Length = 526 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLY+YMAPYVS+SPRAAY NYRDLDLG NN GNTSY QA Sbjct: 445 RRLYAYMAPYVSKSPRAAYLNYRDLDLGRNNNGNTSYAQA 484 >ref|XP_004293695.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Fragaria vesca subsp. vesca] Length = 526 Score = 72.8 bits (177), Expect = 4e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLY+YMAPYVS+SPRAAY NYRDLDLG N+ GNTSY QA Sbjct: 445 RRLYAYMAPYVSKSPRAAYLNYRDLDLGRNSDGNTSYAQA 484 >ref|XP_006352996.1| PREDICTED: cannabidiolic acid synthase-like [Solanum tuberosum] Length = 530 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 R LY YMA YVS+SPRAAYFNYRDLDLG+NN GNTSY QA Sbjct: 452 RNLYGYMARYVSKSPRAAYFNYRDLDLGVNNKGNTSYEQA 491 >ref|XP_002523149.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537556|gb|EEF39180.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 469 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLYS++APYVS++PRAAY NYRDLD+G+NN GNTSY+QA Sbjct: 390 RRLYSFLAPYVSKNPRAAYINYRDLDIGINNLGNTSYKQA 429 >ref|XP_006353077.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum tuberosum] Length = 494 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 S+++Y+Y+ YVS+SPRAAYFNYRDLDLGMNN GNTSY QA Sbjct: 415 SQKIYTYLGKYVSKSPRAAYFNYRDLDLGMNNKGNTSYEQA 455 >ref|XP_002299020.2| hypothetical protein POPTR_0001s46600g [Populus trichocarpa] gi|550350031|gb|EEE83825.2| hypothetical protein POPTR_0001s46600g [Populus trichocarpa] Length = 533 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLYSYMA YVS++PR AY NYRDLDLG+NN GNTSYRQA Sbjct: 454 RRLYSYMASYVSKNPRQAYVNYRDLDLGVNNLGNTSYRQA 493 >gb|EOY01556.1| FAD-binding Berberine family protein [Theobroma cacao] Length = 542 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/41 (85%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGN-TSYRQA 125 RRLYSYMAPYVS+SPR AY NYRDLDLG NN GN TSYRQA Sbjct: 462 RRLYSYMAPYVSKSPREAYVNYRDLDLGTNNKGNYTSYRQA 502 >ref|XP_002317088.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa] gi|550328514|gb|EEE97700.2| hypothetical protein POPTR_0011s16190g [Populus trichocarpa] Length = 538 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 RRLY+YMAPYVS SPRAAY NYRDLDLG NN GNTS+ +A Sbjct: 451 RRLYAYMAPYVSNSPRAAYLNYRDLDLGRNNNGNTSFAKA 490 >emb|CBI22014.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 +R+LY YMAPYVS+SPRAAY NYRDLDLG N GNTSY QA Sbjct: 331 TRKLYKYMAPYVSKSPRAAYLNYRDLDLGRNKNGNTSYAQA 371 >ref|XP_002277294.1| PREDICTED: reticuline oxidase-like protein-like [Vitis vinifera] Length = 536 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 +R+LY YMAPYVS+SPRAAY NYRDLDLG N GNTSY QA Sbjct: 454 TRKLYKYMAPYVSKSPRAAYLNYRDLDLGRNKNGNTSYAQA 494 >ref|XP_002332196.1| predicted protein [Populus trichocarpa] gi|566154489|ref|XP_006370482.1| FAD-binding domain-containing family protein [Populus trichocarpa] gi|550349675|gb|ERP67051.1| FAD-binding domain-containing family protein [Populus trichocarpa] Length = 527 Score = 70.9 bits (172), Expect = 2e-10 Identities = 33/41 (80%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNN-PGNTSYRQA 125 RRLYSY+APYVS++PRAAY NYRDLD+G+NN GNTSYRQA Sbjct: 447 RRLYSYLAPYVSKTPRAAYVNYRDLDIGINNHAGNTSYRQA 487 >emb|CAN63059.1| hypothetical protein VITISV_004192 [Vitis vinifera] Length = 536 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 +R+LY YMAPYVS+SPRAAY NYRDLDLG N GNTSY QA Sbjct: 454 TRKLYKYMAPYVSKSPRAAYLNYRDLDLGRNKNGNTSYAQA 494 >ref|XP_006353079.1| PREDICTED: cannabidiolic acid synthase-like [Solanum tuberosum] Length = 457 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 R LY YM YVS+ PRAAYFNYRDLDLGMNN GNTSY QA Sbjct: 379 RELYEYMGKYVSKYPRAAYFNYRDLDLGMNNKGNTSYEQA 418 >gb|EOY25658.1| FAD-binding Berberine family protein [Theobroma cacao] Length = 528 Score = 70.1 bits (170), Expect = 3e-10 Identities = 34/41 (82%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGN-TSYRQA 125 RRLY YM PYVS+SPRAAY NYRDLDLG NN GN TSYRQA Sbjct: 450 RRLYKYMEPYVSKSPRAAYMNYRDLDLGSNNKGNYTSYRQA 490 >ref|XP_004233882.1| PREDICTED: cannabidiolic acid synthase-like [Solanum lycopersicum] Length = 492 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 R LY YMA YVS+SPRAAY NYRDLDLG+NN GNTSY QA Sbjct: 414 RNLYGYMARYVSRSPRAAYLNYRDLDLGVNNKGNTSYEQA 453 >ref|XP_006353076.1| PREDICTED: tetrahydrocannabinolic acid synthase-like [Solanum tuberosum] Length = 532 Score = 69.7 bits (169), Expect = 4e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 +R+LY YMA YVS+SPRAAYFNYRDLDLG+NN NTSY QA Sbjct: 453 NRKLYRYMAKYVSKSPRAAYFNYRDLDLGVNNKRNTSYDQA 493 >ref|XP_006352995.1| PREDICTED: cannabidiolic acid synthase-like [Solanum tuberosum] Length = 535 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/42 (80%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRRLYSYMAPYVSQSPRAAYFNYRDLDLGMNN-PGNTSYRQA 125 SR+LY YMA YVS+SPRAAYFNYRDLDLG NN GNTSY QA Sbjct: 455 SRKLYGYMAKYVSKSPRAAYFNYRDLDLGFNNINGNTSYEQA 496 >ref|XP_002299025.2| hypothetical protein POPTR_0001s46650g [Populus trichocarpa] gi|550350036|gb|EEE83830.2| hypothetical protein POPTR_0001s46650g [Populus trichocarpa] Length = 487 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +3 Query: 6 RRLYSYMAPYVSQSPRAAYFNYRDLDLGMNNPGNTSYRQA 125 R+LYSYM PYV+++PR AY NYRDLDLGMN+ GNTSY+QA Sbjct: 408 RKLYSYMTPYVTKNPRQAYINYRDLDLGMNSLGNTSYKQA 447