BLASTX nr result
ID: Rehmannia24_contig00005054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia24_contig00005054 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS68012.1| hypothetical protein M569_06763 [Genlisea aurea] 60 4e-07 ref|XP_002960899.1| hypothetical protein SELMODRAFT_437354 [Sela... 57 3e-06 ref|XP_002967113.1| hypothetical protein SELMODRAFT_144759 [Sela... 57 3e-06 ref|XP_006474112.1| PREDICTED: EG45-like domain containing prote... 55 7e-06 gb|ABX46166.1| blight-associated protein P12, partial [Citrus tr... 55 1e-05 >gb|EPS68012.1| hypothetical protein M569_06763 [Genlisea aurea] Length = 127 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = +3 Query: 3 VRVVDLCPGCQANQFDLSQEAFSMIADPNAGRILIEYNE 119 V +VDLCPGC NQFDLS EAFS+I +P+AGRI I+Y + Sbjct: 89 VTIVDLCPGCGPNQFDLSYEAFSVIGNPDAGRIQIDYTQ 127 >ref|XP_002960899.1| hypothetical protein SELMODRAFT_437354 [Selaginella moellendorffii] gi|300171838|gb|EFJ38438.1| hypothetical protein SELMODRAFT_437354 [Selaginella moellendorffii] Length = 200 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 VRVVDLCPGCQANQFDLSQEAFSMIADPNAGRILI 107 VRVVDLCPGC AN FDLS EAF+ IA+P+ GRI I Sbjct: 135 VRVVDLCPGCHANSFDLSYEAFTRIANPDVGRIRI 169 >ref|XP_002967113.1| hypothetical protein SELMODRAFT_144759 [Selaginella moellendorffii] gi|300165104|gb|EFJ31712.1| hypothetical protein SELMODRAFT_144759 [Selaginella moellendorffii] Length = 193 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 VRVVDLCPGCQANQFDLSQEAFSMIADPNAGRILI 107 VRVVDLCPGC AN FDLS EAF+ IA+P+ GRI I Sbjct: 128 VRVVDLCPGCHANSFDLSYEAFTRIANPDVGRIRI 162 >ref|XP_006474112.1| PREDICTED: EG45-like domain containing protein-like [Citrus sinensis] gi|75267717|sp|Q9ZP41.1|EGC_CITJA RecName: Full=EG45-like domain containing protein; AltName: Full=Blight-associated protein p12; AltName: Full=Plant natriuretic peptide; Short=PNP; Flags: Precursor gi|4102727|gb|AAD03398.1| blight-associated protein p12 precursor [Citrus jambhiri] Length = 131 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/41 (68%), Positives = 35/41 (85%), Gaps = 1/41 (2%) Frame = +3 Query: 3 VRVVDLCP-GCQANQFDLSQEAFSMIADPNAGRILIEYNEA 122 V++VDLCP GCQA DLSQEAFS IA+P+AG+I IE+N+A Sbjct: 92 VKIVDLCPAGCQAT-IDLSQEAFSQIANPDAGKIKIEFNQA 131 >gb|ABX46166.1| blight-associated protein P12, partial [Citrus trifoliata] Length = 115 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/39 (71%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +3 Query: 3 VRVVDLCP-GCQANQFDLSQEAFSMIADPNAGRILIEYN 116 V++VDLCP GCQA DLSQEAFS IADP+AG+I IE+N Sbjct: 78 VKIVDLCPAGCQAT-IDLSQEAFSQIADPDAGKIKIEFN 115