BLASTX nr result
ID: Rehmannia23_contig00033534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00033534 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006345318.1| PREDICTED: uncharacterized protein LOC102581... 65 7e-09 ref|XP_002526851.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_006345318.1| PREDICTED: uncharacterized protein LOC102581842 [Solanum tuberosum] Length = 278 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/64 (43%), Positives = 36/64 (56%) Frame = +1 Query: 1 LGSTMIWVDFKYENLLTFCYYCGCVGHTEKFCEKRRADIVESQLLEGQFGDWIKADGFSG 180 LGS WV+ YENL CYYCG +GH EK C R D+ + + QFG W+KA+ + Sbjct: 189 LGSETTWVEISYENLPYVCYYCGLLGHNEKTCAHRAKDVQDGTVKTDQFGIWLKAENHAS 248 Query: 181 PGRK 192 K Sbjct: 249 FSEK 252 >ref|XP_002526851.1| conserved hypothetical protein [Ricinus communis] gi|223533750|gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] Length = 335 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/57 (43%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Frame = +1 Query: 16 IWVDFKYENLLTFCYYCGCVGHTEKFCEKRRA----DIVESQLLEGQFGDWIKADGF 174 +WV F+YE L +FCY CGC+GH + C+ R D ++ +LL FGDW++A F Sbjct: 60 MWVFFRYERLPSFCYVCGCLGHVMRDCDSRTEDDGYDAMDEKLL--PFGDWMRASPF 114