BLASTX nr result
ID: Rehmannia23_contig00033501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00033501 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302391.2| hypothetical protein POPTR_0002s11630g [Popu... 49 3e-06 >ref|XP_002302391.2| hypothetical protein POPTR_0002s11630g [Populus trichocarpa] gi|550344797|gb|EEE81664.2| hypothetical protein POPTR_0002s11630g [Populus trichocarpa] Length = 434 Score = 48.9 bits (115), Expect(2) = 3e-06 Identities = 44/138 (31%), Positives = 67/138 (48%), Gaps = 19/138 (13%) Frame = -3 Query: 547 KLLAQFLQEQQEPFALEVYLLERGYSKGTTRDAAST-----NSRFFKAKRRYVD------ 401 K L + LQEQQEPF L +YLLERGYS+ ++ +S+ NSR K+++R V Sbjct: 26 KQLRELLQEQQEPFILNIYLLERGYSRKSSDSESSSRFCHVNSR--KSQKRSVGRGLNIS 83 Query: 400 ---VPHCSEFVKAVFG-----RHSNRKISKNHGIAGRKCNFPKNRESVEEHADEDEFSCS 245 P S+ ++AV + R S +H G K + S ++ A+ D FS + Sbjct: 84 KRVNPQGSKVLRAVLKQVISIKQMLRINSSDH--RGGKLKVNEKGRSNQQVAESDIFSTA 141 Query: 244 ESDANGNIFSEEKLAG*C 191 S N S+ ++ C Sbjct: 142 SSTTVFNSISKSEVEAPC 159 Score = 27.7 bits (60), Expect(2) = 3e-06 Identities = 20/39 (51%), Positives = 26/39 (66%) Frame = -1 Query: 192 AERKLKWRINMEDGNKQLSPVSVLEETESDQGSSPVHHS 76 A+RKL+ R +ED ++QLSP SVLE S G SP +S Sbjct: 187 ADRKLQQR-GIED-SRQLSPASVLEGIPS-HGRSPFQNS 222