BLASTX nr result
ID: Rehmannia23_contig00033339
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00033339 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536697.1| PREDICTED: vesicle-associated membrane prote... 36 7e-08 gb|ACU24529.1| unknown [Glycine max] 36 7e-08 gb|ACU23563.1| unknown [Glycine max] 36 7e-08 gb|EOY19233.1| Vesicle-associated membrane protein 727 [Theobrom... 36 2e-07 ref|XP_003555880.1| PREDICTED: vesicle-associated membrane prote... 36 2e-07 ref|XP_003637224.1| Vesicle-associated membrane protein [Medicag... 36 2e-07 ref|XP_006485186.1| PREDICTED: vesicle-associated membrane prote... 36 3e-07 ref|XP_004306429.1| PREDICTED: vesicle-associated membrane prote... 36 3e-07 gb|AFK42000.1| unknown [Lotus japonicus] 36 3e-07 gb|ESW14859.1| hypothetical protein PHAVU_007G023300g [Phaseolus... 36 3e-07 ref|XP_006445743.1| hypothetical protein CICLE_v10016922mg [Citr... 36 4e-07 gb|EXB36993.1| Vesicle-associated membrane protein 727 [Morus no... 34 4e-07 ref|XP_004497141.1| PREDICTED: vesicle-associated membrane prote... 36 6e-07 ref|XP_002311006.1| Vesicle-associated membrane protein 727 [Pop... 36 6e-07 ref|XP_002515759.1| Vesicle-associated membrane protein, putativ... 36 6e-07 ref|XP_006361486.1| PREDICTED: vesicle-associated membrane prote... 36 9e-07 ref|XP_002269134.1| PREDICTED: vesicle-associated membrane prote... 36 9e-07 gb|EMJ19494.1| hypothetical protein PRUPE_ppa010737mg [Prunus pe... 36 1e-06 ref|XP_004249955.1| PREDICTED: vesicle-associated membrane prote... 36 2e-06 ref|XP_004170493.1| PREDICTED: vesicle-associated membrane prote... 37 2e-06 >ref|XP_003536697.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X1 [Glycine max] gi|571484986|ref|XP_006589712.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X2 [Glycine max] gi|571484988|ref|XP_006589713.1| PREDICTED: vesicle-associated membrane protein 727-like isoform X3 [Glycine max] Length = 238 Score = 36.2 bits (82), Expect(3) = 7e-08 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 35.0 bits (79), Expect(3) = 7e-08 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GRS+PFVFLE+VK G ++ P+ DDEDDD Sbjct: 74 GRSVPFVFLERVKDDFMKRYGASIKNDGAHPLADDEDDD 112 Score = 30.0 bits (66), Expect(3) = 7e-08 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPALK 134 >gb|ACU24529.1| unknown [Glycine max] Length = 238 Score = 36.2 bits (82), Expect(3) = 7e-08 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 35.0 bits (79), Expect(3) = 7e-08 Identities = 19/39 (48%), Positives = 24/39 (61%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GRS+PFVFLE+VK G ++ P+ DDEDDD Sbjct: 74 GRSVPFVFLERVKDDFMKRYGASIKNDGAHPLADDEDDD 112 Score = 30.0 bits (66), Expect(3) = 7e-08 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPALK 134 >gb|ACU23563.1| unknown [Glycine max] Length = 238 Score = 35.8 bits (81), Expect(3) = 7e-08 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKG+MMDNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 35.4 bits (80), Expect(3) = 7e-08 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GRS+PFVFLE+VK GV ++ P+ DD+DDD Sbjct: 74 GRSVPFVFLERVKDDFMKRYGVSIKNEGAHPLADDDDDD 112 Score = 30.0 bits (66), Expect(3) = 7e-08 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPALK 134 >gb|EOY19233.1| Vesicle-associated membrane protein 727 [Theobroma cacao] Length = 238 Score = 36.2 bits (82), Expect(3) = 2e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 32.7 bits (73), Expect(3) = 2e-07 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GRS+PFVFLE+V+ G ++ L P+ DD++DD Sbjct: 74 GRSVPFVFLERVQDDFKQRYGASIKNEGLHPLADDDEDD 112 Score = 31.2 bits (69), Expect(3) = 2e-07 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG +LK Sbjct: 114 LFEDRFSIAYNLDREFGPRLK 134 >ref|XP_003555880.1| PREDICTED: vesicle-associated membrane protein 727-like [Glycine max] Length = 238 Score = 36.2 bits (82), Expect(3) = 2e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 33.9 bits (76), Expect(3) = 2e-07 Identities = 18/39 (46%), Positives = 24/39 (61%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GRS+PFVFLE+VK G ++ P+ DD+DDD Sbjct: 74 GRSVPFVFLERVKDDFMKRYGASIKNEGAHPLADDDDDD 112 Score = 30.0 bits (66), Expect(3) = 2e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPALK 134 >ref|XP_003637224.1| Vesicle-associated membrane protein [Medicago truncatula] gi|355503159|gb|AES84362.1| Vesicle-associated membrane protein [Medicago truncatula] Length = 238 Score = 36.2 bits (82), Expect(3) = 2e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 33.5 bits (75), Expect(3) = 2e-07 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDDEDDD 345 GRS+PFVFLE+VK + + + P+ DD++DD Sbjct: 74 GRSVPFVFLERVKDDFNQRYGASIKIASDHPLADDDEDD 112 Score = 30.4 bits (67), Expect(3) = 2e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPSLK 134 >ref|XP_006485186.1| PREDICTED: vesicle-associated membrane protein 727-like [Citrus sinensis] Length = 238 Score = 36.2 bits (82), Expect(3) = 3e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 32.0 bits (71), Expect(3) = 3e-07 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDDEDDD 345 GRS+PFVFLE+VK + P+ DD++DD Sbjct: 74 GRSVPFVFLERVKDDFKQRYGASIQNEESHPLADDDEDD 112 Score = 31.2 bits (69), Expect(3) = 3e-07 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG +LK Sbjct: 114 LFEDRFSIAYNLDREFGPRLK 134 >ref|XP_004306429.1| PREDICTED: vesicle-associated membrane protein 727-like [Fragaria vesca subsp. vesca] Length = 238 Score = 35.8 bits (81), Expect(3) = 3e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKG+MMDNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 32.3 bits (72), Expect(3) = 3e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG KLK Sbjct: 114 LFEDRFSIAYNLDREFGPKLK 134 Score = 31.2 bits (69), Expect(3) = 3e-07 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 10/42 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVKGVMVRTL*PIV----------DDEDDDCF 339 GRS+PFVFLE+VK ++ P + +DEDD F Sbjct: 74 GRSVPFVFLERVKADFMQRYAPSIKNEGPHPLADEDEDDALF 115 >gb|AFK42000.1| unknown [Lotus japonicus] Length = 207 Score = 36.2 bits (82), Expect(3) = 3e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 124 AQITEVKGIMMDNIEKV 140 Score = 33.1 bits (74), Expect(3) = 3e-07 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVKGVMVRTL---------*PIVDDEDDD 345 GRS+PFVFLE+VK ++ P+ DD+DDD Sbjct: 43 GRSVPFVFLERVKDDFMQRYGASIENASDHPLADDDDDD 81 Score = 30.0 bits (66), Expect(3) = 3e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 83 LFEDRFSIAYNLDREFGPALK 103 >gb|ESW14859.1| hypothetical protein PHAVU_007G023300g [Phaseolus vulgaris] Length = 238 Score = 36.2 bits (82), Expect(3) = 3e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 32.7 bits (73), Expect(3) = 3e-07 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVKGVMVR---------TL*PIVDDEDDD 345 GRS+PFVFLE+VK ++ + P+ DD++DD Sbjct: 74 GRSVPFVFLERVKDDFMKRYGASINNGSTHPLADDDEDD 112 Score = 30.0 bits (66), Expect(3) = 3e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPALK 134 >ref|XP_006445743.1| hypothetical protein CICLE_v10016922mg [Citrus clementina] gi|557548354|gb|ESR58983.1| hypothetical protein CICLE_v10016922mg [Citrus clementina] Length = 176 Score = 35.8 bits (81), Expect(3) = 4e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEK+ Sbjct: 155 AQITEVKGIMMDNIEKI 171 Score = 32.0 bits (71), Expect(3) = 4e-07 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDDEDDD 345 GRS+PFVFLE+VK + P+ DD++DD Sbjct: 74 GRSVPFVFLERVKDDFKQRYGASIQNEESHPLADDDEDD 112 Score = 31.2 bits (69), Expect(3) = 4e-07 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG +LK Sbjct: 114 LFEDRFSIAYNLDREFGPRLK 134 >gb|EXB36993.1| Vesicle-associated membrane protein 727 [Morus notabilis] Length = 200 Score = 33.9 bits (76), Expect(3) = 4e-07 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKVHFLF 190 AQI+EVKGIMMDNIEK F Sbjct: 149 AQISEVKGIMMDNIEKQELSF 169 Score = 33.5 bits (75), Expect(3) = 4e-07 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDDEDDD 345 GRS+PFVFLE+VK G+ P+ DD++DD Sbjct: 68 GRSVPFVFLERVKDDFRQRYGGGIKEEGPHPLADDDEDD 106 Score = 31.2 bits (69), Expect(3) = 4e-07 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG +LK Sbjct: 108 LFEDRFSIAYNLDREFGPRLK 128 >ref|XP_004497141.1| PREDICTED: vesicle-associated membrane protein 727-like [Cicer arietinum] Length = 238 Score = 36.2 bits (82), Expect(3) = 6e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 32.7 bits (73), Expect(3) = 6e-07 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRTL--*PIVDDEDDD 345 GRS+PFVFLE+VK G +++ P+ DD++DD Sbjct: 74 GRSVPFVFLERVKDDFKQRYGASIKSASDHPLADDDEDD 112 Score = 29.3 bits (64), Expect(3) = 6e-07 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG LK Sbjct: 114 LFEDRFSIAYNLDREFGPILK 134 >ref|XP_002311006.1| Vesicle-associated membrane protein 727 [Populus trichocarpa] gi|222850826|gb|EEE88373.1| Vesicle-associated membrane protein 727 [Populus trichocarpa] Length = 238 Score = 36.2 bits (82), Expect(3) = 6e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 155 AQITEVKGIMMDNIEKV 171 Score = 31.2 bits (69), Expect(3) = 6e-07 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 8/38 (21%) Frame = -3 Query: 434 GRSIPFVFLEKVK--------GVMVRTL*PIVDDEDDD 345 GR +PFVFLE+VK + P+ DD+DDD Sbjct: 75 GRGLPFVFLERVKDDFKQRYSASIKNEAHPLADDDDDD 112 Score = 30.8 bits (68), Expect(3) = 6e-07 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR S+AYN REFG +LK Sbjct: 114 LFEDRFSVAYNLDREFGPRLK 134 >ref|XP_002515759.1| Vesicle-associated membrane protein, putative [Ricinus communis] gi|223545087|gb|EEF46598.1| Vesicle-associated membrane protein, putative [Ricinus communis] Length = 237 Score = 36.2 bits (82), Expect(3) = 6e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 154 AQITEVKGIMMDNIEKV 170 Score = 32.7 bits (73), Expect(3) = 6e-07 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 8/38 (21%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT-L*PIVDDEDDD 345 GRS+PFVFLE+VK G + P+ DD+DDD Sbjct: 74 GRSVPFVFLERVKDDFKQRYGAGINNEAHPLADDDDDD 111 Score = 29.3 bits (64), Expect(3) = 6e-07 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F DR SIAYN R+FG +LK Sbjct: 113 LFADRFSIAYNLDRDFGPRLK 133 >ref|XP_006361486.1| PREDICTED: vesicle-associated membrane protein 727-like [Solanum tuberosum] Length = 240 Score = 36.2 bits (82), Expect(3) = 9e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 157 AQITEVKGIMMDNIEKV 173 Score = 31.2 bits (69), Expect(3) = 9e-07 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F DR SIAYN REFG KLK Sbjct: 116 LFGDRFSIAYNLDREFGPKLK 136 Score = 30.0 bits (66), Expect(3) = 9e-07 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 12/44 (27%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT---L*PIVDD--EDDDCF 339 GRS+PFVFLE+VK G ++ P+ DD EDDD F Sbjct: 74 GRSVPFVFLERVKDDFKKRYGSSIKNDGDPHPLADDNEEDDDLF 117 >ref|XP_002269134.1| PREDICTED: vesicle-associated membrane protein 727 isoform 1 [Vitis vinifera] gi|296086578|emb|CBI32213.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 36.2 bits (82), Expect(3) = 9e-07 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 156 AQITEVKGIMMDNIEKV 172 Score = 32.3 bits (72), Expect(3) = 9e-07 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG KLK Sbjct: 115 LFEDRFSIAYNLDREFGPKLK 135 Score = 28.9 bits (63), Expect(3) = 9e-07 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK-------GVMVRT--L*PIVDDEDDD 345 GR PFVFLE+VK G +R+ P+ D++DDD Sbjct: 74 GRGAPFVFLERVKDDFKQRYGGSIRSDGPHPLADEDDDD 112 >gb|EMJ19494.1| hypothetical protein PRUPE_ppa010737mg [Prunus persica] Length = 238 Score = 35.8 bits (81), Expect(3) = 1e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKG+MMDNIEKV Sbjct: 155 AQITEVKGVMMDNIEKV 171 Score = 31.2 bits (69), Expect(3) = 1e-06 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F+DR SIAYN REFG +LK Sbjct: 114 LFEDRFSIAYNLDREFGPRLK 134 Score = 30.0 bits (66), Expect(3) = 1e-06 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 10/42 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDD-EDDDCF 339 GRS+PFVFLE+VK + P+ DD EDDD F Sbjct: 74 GRSMPFVFLERVKEDFKQRYGSNNKIEGPHPLADDNEDDDLF 115 >ref|XP_004249955.1| PREDICTED: vesicle-associated membrane protein 727-like [Solanum lycopersicum] Length = 240 Score = 36.2 bits (82), Expect(3) = 2e-06 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKV 202 AQITEVKGIMMDNIEKV Sbjct: 157 AQITEVKGIMMDNIEKV 173 Score = 31.2 bits (69), Expect(3) = 2e-06 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F DR SIAYN REFG KLK Sbjct: 116 LFGDRFSIAYNLDREFGPKLK 136 Score = 29.3 bits (64), Expect(3) = 2e-06 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 12/44 (27%) Frame = -3 Query: 434 GRSIPFVFLEKVKGVMVRTL*PIV------------DDEDDDCF 339 GRS+PFVFLE+VK + + D+EDDD F Sbjct: 74 GRSVPFVFLERVKDDFKKRYGSSIKNDGDPHPLADGDEEDDDLF 117 >ref|XP_004170493.1| PREDICTED: vesicle-associated membrane protein 727-like [Cucumis sativus] Length = 175 Score = 36.6 bits (83), Expect(3) = 2e-06 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 252 AQITEVKGIMMDNIEKVHFLFI 187 AQITEVKGIMMDNIEKV LF+ Sbjct: 155 AQITEVKGIMMDNIEKVR-LFV 175 Score = 31.2 bits (69), Expect(3) = 2e-06 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 9/39 (23%) Frame = -3 Query: 434 GRSIPFVFLEKVK---------GVMVRTL*PIVDDEDDD 345 GR++PFVFL++VK + P+ DDEDDD Sbjct: 74 GRNMPFVFLDRVKDDFKQRYGSSIKDENPHPLADDEDDD 112 Score = 28.5 bits (62), Expect(3) = 2e-06 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 343 VFKDRLSIAYNPVREFGRKLK 281 +F DR S+AY REFG KLK Sbjct: 114 LFLDRFSVAYTLDREFGPKLK 134