BLASTX nr result
ID: Rehmannia23_contig00032832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032832 (394 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67944.1| hypothetical protein M569_06828, partial [Genlise... 59 9e-07 >gb|EPS67944.1| hypothetical protein M569_06828, partial [Genlisea aurea] Length = 375 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +2 Query: 134 RDNCSSANGLPPIPNSLGGRGGAYRHCLNPDGTPPLCTKSLIRHPSLVI 280 RD+CSS NG PPIPNS G G YR CL+ +G LCT L+RH +L I Sbjct: 3 RDSCSSGNGRPPIPNSFGS-GTPYRKCLDANGALKLCTTPLVRHQALEI 50