BLASTX nr result
ID: Rehmannia23_contig00032699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00032699 (415 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73132.1| hypothetical protein M569_01623, partial [Genlise... 60 3e-07 >gb|EPS73132.1| hypothetical protein M569_01623, partial [Genlisea aurea] Length = 150 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 150 RAWNVAIYYCHNCTELGSTKILQFLQFGASQSGRST 257 RAWN+A+YY NCTELGSTK+LQFL+F +SQS R T Sbjct: 115 RAWNLAVYYWQNCTELGSTKVLQFLEFVSSQSARFT 150