BLASTX nr result
ID: Rehmannia23_contig00031954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031954 (555 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulg... 60 3e-07 >ref|YP_004222277.1| hypothetical protein BevumaM_p039 [Beta vulgaris subsp. maritima] gi|346683152|ref|YP_004842084.1| hypothetical protein BemaM_p037 [Beta macrocarpa] gi|317905712|emb|CBX33240.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439792|emb|CBX33292.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148721|emb|CBJ23359.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500070|emb|CBX24886.1| hypothetical protein [Beta macrocarpa] gi|384939198|emb|CBL52045.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 102 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 223 QFLRKLFLTSQVVQQLYLTARRGGSPFEFNR 315 QFLRKLFLTSQVVQQLYL ARRGGSPFEF+R Sbjct: 72 QFLRKLFLTSQVVQQLYLIARRGGSPFEFSR 102