BLASTX nr result
ID: Rehmannia23_contig00031950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031950 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526851.1| conserved hypothetical protein [Ricinus comm... 66 4e-09 >ref|XP_002526851.1| conserved hypothetical protein [Ricinus communis] gi|223533750|gb|EEF35482.1| conserved hypothetical protein [Ricinus communis] Length = 335 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/78 (37%), Positives = 47/78 (60%) Frame = -1 Query: 393 RLPIFCFRCGIMGHMNRDCXXXXXEDNYENVSDDNLPFGDWIKASPMKHAQVTVEAHKRT 214 RLP FC+ CG +GH+ RDC +D Y+ + + LPFGDW++ASP K +V ++ ++ Sbjct: 68 RLPSFCYVCGCLGHVMRDCDSRTEDDGYDAMDEKLLPFGDWMRASPFKRTKVIIQDESKS 127 Query: 213 DLQNPRRSLFPPRKSMEL 160 R+ L+ K +E+ Sbjct: 128 --YKTRKCLYNNPKVVEI 143