BLASTX nr result
ID: Rehmannia23_contig00031857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031857 (410 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27550.3| unnamed protein product [Vitis vinifera] 65 9e-09 ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containi... 65 9e-09 gb|EXB94964.1| hypothetical protein L484_006728 [Morus notabilis] 63 4e-08 gb|EPS71950.1| hypothetical protein M569_02808 [Genlisea aurea] 63 5e-08 emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] 62 6e-08 ref|XP_006379941.1| hypothetical protein POPTR_0008s17930g, part... 60 2e-07 ref|XP_006341756.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 ref|XP_004239182.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_003548528.2| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006484038.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 ref|XP_006438113.1| hypothetical protein CICLE_v10031257mg [Citr... 56 6e-06 >emb|CBI27550.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKSS 278 EM+G+ I PRY TC+LLL EIKQKNMHDAAE IE +MK+MK+S Sbjct: 287 EMVGKAITPRYKTCALLLDEIKQKNMHDAAERIEVFMKQMKTS 329 >ref|XP_002266563.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial [Vitis vinifera] Length = 496 Score = 65.1 bits (157), Expect = 9e-09 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKSS 278 EM+G+ I PRY TC+LLL EIKQKNMHDAAE IE +MK+MK+S Sbjct: 453 EMVGKAITPRYKTCALLLDEIKQKNMHDAAERIEVFMKQMKTS 495 >gb|EXB94964.1| hypothetical protein L484_006728 [Morus notabilis] Length = 489 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKM 287 EM+GQ I PRY TC LL +E+KQK+M+DAAE IED+MKKM Sbjct: 450 EMIGQGIMPRYKTCRLLFEEVKQKHMYDAAEKIEDFMKKM 489 >gb|EPS71950.1| hypothetical protein M569_02808 [Genlisea aurea] Length = 491 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKS 281 EM+G+N+ PRY TCSLLL EI++K M+DAA+++ED+M KMKS Sbjct: 447 EMVGRNLVPRYKTCSLLLHEIREKCMYDAADMVEDFMNKMKS 488 >emb|CAN63349.1| hypothetical protein VITISV_024448 [Vitis vinifera] Length = 324 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKSS 278 EM+ + I PRY TC+LLL EIKQKNMHDAAE IE +MK+MK+S Sbjct: 143 EMVXKAITPRYKTCALLLDEIKQKNMHDAAEGIEVFMKQMKTS 185 >ref|XP_006379941.1| hypothetical protein POPTR_0008s17930g, partial [Populus trichocarpa] gi|550333337|gb|ERP57738.1| hypothetical protein POPTR_0008s17930g, partial [Populus trichocarpa] Length = 388 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKM 287 EM+G+NI P+Y TC LLL+E+K KNM+D AE IED+MKK+ Sbjct: 349 EMIGKNIVPKYQTCHLLLEEVKLKNMYDTAEKIEDFMKKL 388 >ref|XP_006341756.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Solanum tuberosum] Length = 522 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKS 281 +M+ Q I PRY TCS+LLQEIKQKNM++AA+ IE +MKKMK+ Sbjct: 480 DMVRQEITPRYKTCSVLLQEIKQKNMYEAADKIELFMKKMKA 521 >ref|XP_004239182.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Solanum lycopersicum] Length = 518 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKMKSS 278 +M+ + I PRY TCS+LLQEIKQKNM++AA+ IE +MKKMK++ Sbjct: 476 DMVRKEITPRYKTCSVLLQEIKQKNMYEAADKIELFMKKMKAA 518 >ref|XP_003548528.2| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like [Glycine max] Length = 471 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKM 287 EM+ Q+I PRY TC LLL E+KQKNM+ AAE IED MKK+ Sbjct: 432 EMIDQDIIPRYRTCRLLLDEVKQKNMYQAAEKIEDLMKKL 471 >ref|XP_006484038.1| PREDICTED: pentatricopeptide repeat-containing protein At3g04130, mitochondrial-like isoform X1 [Citrus sinensis] Length = 515 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKM 287 EM+G +I PRY TC L+L E+KQK+M+DAAE IE MKK+ Sbjct: 476 EMIGHDITPRYQTCRLILDEVKQKHMYDAAEKIEAVMKKL 515 >ref|XP_006438113.1| hypothetical protein CICLE_v10031257mg [Citrus clementina] gi|557540309|gb|ESR51353.1| hypothetical protein CICLE_v10031257mg [Citrus clementina] Length = 515 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -2 Query: 406 EMLGQNIKPRYLTCSLLLQEIKQKNMHDAAEVIEDYMKKM 287 EM+G +I PRY TC L+L E+KQK+M+DAAE IE MKK+ Sbjct: 476 EMIGHDITPRYQTCRLILDEVKQKHMYDAAEKIEAVMKKL 515