BLASTX nr result
ID: Rehmannia23_contig00031023
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00031023 (513 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus pe... 64 2e-08 ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protei... 55 7e-06 gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isof... 55 7e-06 gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isof... 55 7e-06 >gb|EMJ23233.1| hypothetical protein PRUPE_ppa003040mg [Prunus persica] Length = 609 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/57 (54%), Positives = 45/57 (78%) Frame = -2 Query: 512 SSYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKADLR 342 +S+ R+ SII++AE+MSD+LK C +PR LVK+ PEN V A +L+EDIKRKA+++ Sbjct: 553 ASHARRKSIIQKAEAMSDLLKTCSDPRELVKYRSLPENVVSRANQLVEDIKRKANIQ 609 >ref|XP_002282419.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial [Vitis vinifera] gi|296081989|emb|CBI20994.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/55 (56%), Positives = 41/55 (74%) Frame = -2 Query: 512 SSYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKAD 348 +S RK SII+RAE+MSD+LK C +PR LVK EN V+ A +L+EDIKR+A+ Sbjct: 541 ASRARKTSIIQRAEAMSDILKTCNDPRELVKRRSSFENTVLVADQLIEDIKRRAN 595 >ref|XP_004292965.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 582 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/56 (53%), Positives = 41/56 (73%) Frame = -2 Query: 509 SYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKADLR 342 S+ R+ SIIK+AE+MS VLK C +PR LVKH PE+ A +L+EDIK KA+++ Sbjct: 527 SHERRKSIIKKAEAMSKVLKTCSDPRELVKHRSSPESVESRANRLIEDIKTKANIK 582 >ref|XP_004136469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] gi|449503560|ref|XP_004162063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g11310, mitochondrial-like [Cucumis sativus] Length = 615 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/51 (52%), Positives = 40/51 (78%) Frame = -2 Query: 500 RKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKAD 348 R+ SI+++AE+MS++LK CK+PR LVK E+ V SA KL++DIK+KA+ Sbjct: 561 RRTSIMRKAEAMSEMLKVCKDPRELVKRRSPSEDAVFSANKLIDDIKKKAN 611 >gb|EOY31375.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] gi|508784121|gb|EOY31377.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 4, partial [Theobroma cacao] Length = 560 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -2 Query: 512 SSYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKA 351 SS R+ SI+++AE+MSD+LK CK+PR VKH EN V SA +L+E IK A Sbjct: 500 SSRARRTSIMRKAEAMSDMLKTCKDPREFVKHRTLSENAVSSAGRLIEIIKEGA 553 >gb|EOY31373.1| Pentatricopeptide repeat superfamily protein isoform 2, partial [Theobroma cacao] Length = 584 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -2 Query: 512 SSYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKA 351 SS R+ SI+++AE+MSD+LK CK+PR VKH EN V SA +L+E IK A Sbjct: 524 SSRARRTSIMRKAEAMSDMLKTCKDPREFVKHRTLSENAVSSAGRLIEIIKEGA 577 >gb|EOY31372.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784118|gb|EOY31374.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] gi|508784120|gb|EOY31376.1| Pentatricopeptide repeat superfamily protein isoform 1 [Theobroma cacao] Length = 595 Score = 55.5 bits (132), Expect = 7e-06 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = -2 Query: 512 SSYVRKISIIKRAESMSDVLKACKNPRVLVKHGFRPENDVVSAQKLMEDIKRKA 351 SS R+ SI+++AE+MSD+LK CK+PR VKH EN V SA +L+E IK A Sbjct: 535 SSRARRTSIMRKAEAMSDMLKTCKDPREFVKHRTLSENAVSSAGRLIEIIKEGA 588