BLASTX nr result
ID: Rehmannia23_contig00030811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030811 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002334232.1| predicted protein [Populus trichocarpa] 92 5e-17 ref|XP_002531962.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 >ref|XP_002334232.1| predicted protein [Populus trichocarpa] Length = 150 Score = 92.4 bits (228), Expect = 5e-17 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 305 AKWQIRNLVSTRHREWPMFQEPMLPIRSEPTTERMPAAENAAIVQNAPAEAGVA 144 AKWQIRNLVSTRHREWPMFQEPMLP SEPTTE MPAA+NAA+VQNAP AGVA Sbjct: 6 AKWQIRNLVSTRHREWPMFQEPMLP--SEPTTETMPAADNAALVQNAP--AGVA 55 >ref|XP_002531962.1| conserved hypothetical protein [Ricinus communis] gi|223528385|gb|EEF30423.1| conserved hypothetical protein [Ricinus communis] Length = 353 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 305 AKWQIRNLVSTRHREWPMFQEPMLPIRSEPTTERMPAAE 189 AKWQIRNL STRHREWPMFQEPMLPI+S PT E MP + Sbjct: 296 AKWQIRNLESTRHREWPMFQEPMLPIQSIPTIETMPTVD 334