BLASTX nr result
ID: Rehmannia23_contig00030642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030642 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW07479.1| hypothetical protein PHAVU_010G133300g [Phaseolus... 41 6e-06 >gb|ESW07479.1| hypothetical protein PHAVU_010G133300g [Phaseolus vulgaris] gi|561008531|gb|ESW07480.1| hypothetical protein PHAVU_010G133300g [Phaseolus vulgaris] Length = 348 Score = 41.2 bits (95), Expect(2) = 6e-06 Identities = 21/40 (52%), Positives = 27/40 (67%) Frame = -2 Query: 208 KKGCVHESRNIHA*KRARGYGGNLSNTRSMEN*SCLESKP 89 +K +HESR++HA KRARG GG NT+ +E ESKP Sbjct: 216 RKPYLHESRHLHAMKRARGSGGRFLNTKKLE-----ESKP 250 Score = 34.3 bits (77), Expect(2) = 6e-06 Identities = 20/33 (60%), Positives = 21/33 (63%) Frame = -3 Query: 300 PISVNAKPYHAIRRR*QT*ARLEAFITRAKSRK 202 PI VNAK YHAI RR Q A+LEA K RK Sbjct: 185 PIYVNAKQYHAILRRRQYRAKLEAQNKLIKERK 217