BLASTX nr result
ID: Rehmannia23_contig00030598
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030598 (1070 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006426943.1| hypothetical protein CICLE_v10025322mg [Citr... 59 3e-06 >ref|XP_006426943.1| hypothetical protein CICLE_v10025322mg [Citrus clementina] gi|557528933|gb|ESR40183.1| hypothetical protein CICLE_v10025322mg [Citrus clementina] Length = 542 Score = 58.9 bits (141), Expect = 3e-06 Identities = 38/115 (33%), Positives = 58/115 (50%), Gaps = 2/115 (1%) Frame = -1 Query: 953 SLSTKSFDSFSCNFPCLEELSLFFCSGFEEFQLSSRSIKDLIIEGFDNSIKVVIDVPNIV 774 + S + F NFP LE LSL FC E+ +SS +K+L I+ N + + PN++ Sbjct: 290 TFSDQEFHDLISNFPLLENLSLRFCCSLEKIMISSNRLKELCIDRCVNLKAIDLVTPNLL 349 Query: 773 SFHYEGDIPRSISFTTASSEWKSDIVVWSNVNFDYDAS--SWCLKLNELLKALSE 615 SF Y + + S TAS W+ V F+Y A+ SW + + E L A ++ Sbjct: 350 SFTYVSNPVPTFSI-TASCPWR--------VAFNYGAADVSWYINMKEFLSASNQ 395