BLASTX nr result
ID: Rehmannia23_contig00030563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030563 (322 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS57429.1| hypothetical protein M569_17387, partial [Genlise... 57 2e-06 >gb|EPS57429.1| hypothetical protein M569_17387, partial [Genlisea aurea] Length = 639 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = +3 Query: 198 YGTPSSHPSDHKQRDPKTPSSLDEVESRLKALKLKY 305 YGTP H SDH Q++P TPSSL+EV SRLK LKLKY Sbjct: 35 YGTPVFHASDHNQKEPTTPSSLEEVGSRLKELKLKY 70