BLASTX nr result
ID: Rehmannia23_contig00030541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030541 (306 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004294530.1| PREDICTED: 50S ribosomal protein L15-like [F... 60 4e-07 gb|EMJ02494.1| hypothetical protein PRUPE_ppa008724mg [Prunus pe... 59 7e-07 gb|EMJ13454.1| hypothetical protein PRUPE_ppa013678mg [Prunus pe... 59 9e-07 ref|XP_002298658.2| hypothetical protein POPTR_0001s33180g [Popu... 58 1e-06 ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis ... 57 2e-06 ref|XP_006348181.1| PREDICTED: 54S ribosomal protein L10, mitoch... 57 3e-06 gb|EXC59637.1| hypothetical protein L484_000306 [Morus notabilis] 55 7e-06 gb|EXB76038.1| 50S ribosomal protein L15 [Morus notabilis] 55 7e-06 gb|EMT11945.1| hypothetical protein F775_08463 [Aegilops tauschii] 55 7e-06 dbj|BAK00590.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 7e-06 dbj|BAJ85588.1| predicted protein [Hordeum vulgare subsp. vulgar... 55 7e-06 emb|CBH32598.1| 50S ribosomal protein L15, putative, expressed [... 55 7e-06 tpg|DAA54310.1| TPA: hypothetical protein ZEAMMB73_703096 [Zea m... 55 1e-05 ref|XP_002522195.1| 60S ribosomal protein L10, mitochondrial, pu... 55 1e-05 ref|NP_001130590.1| uncharacterized protein LOC100191689 [Zea ma... 55 1e-05 >ref|XP_004294530.1| PREDICTED: 50S ribosomal protein L15-like [Fragaria vesca subsp. vesca] Length = 285 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEAMPDST 205 PKQKDKVDSIGRLPAPTKPIPF TEE EA S+ Sbjct: 251 PKQKDKVDSIGRLPAPTKPIPFFTEENEAASSSS 284 >gb|EMJ02494.1| hypothetical protein PRUPE_ppa008724mg [Prunus persica] Length = 321 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEAMPDST 205 PKQKDKVDSIGRLPAPTKPIPF TEE+ A ST Sbjct: 288 PKQKDKVDSIGRLPAPTKPIPFFTEEEVASSSST 321 >gb|EMJ13454.1| hypothetical protein PRUPE_ppa013678mg [Prunus persica] Length = 109 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEAMPDST 205 PKQKDKVDSIGRLPAPTKP+PF TEE+ A ST Sbjct: 76 PKQKDKVDSIGRLPAPTKPVPFFTEEEVASSSST 109 >ref|XP_002298658.2| hypothetical protein POPTR_0001s33180g [Populus trichocarpa] gi|550348758|gb|EEE83463.2| hypothetical protein POPTR_0001s33180g [Populus trichocarpa] Length = 269 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEA 220 PK KDKVDSIGRLPAPTKPIPF TEEKEA Sbjct: 236 PKLKDKVDSIGRLPAPTKPIPFYTEEKEA 264 >ref|XP_002268646.1| PREDICTED: 50S ribosomal protein L15 [Vitis vinifera] gi|296085970|emb|CBI31411.3| unnamed protein product [Vitis vinifera] Length = 283 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEA 220 PKQ+DKVDSIGRLPAPTKPIPF EEKEA Sbjct: 249 PKQRDKVDSIGRLPAPTKPIPFLPEEKEA 277 >ref|XP_006348181.1| PREDICTED: 54S ribosomal protein L10, mitochondrial-like [Solanum tuberosum] Length = 282 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEAMPDSTA 202 PK KDKVDSIGRLPAPTKP+PF TEE E+M + A Sbjct: 248 PKLKDKVDSIGRLPAPTKPLPFVTEEAESMSATPA 282 >gb|EXC59637.1| hypothetical protein L484_000306 [Morus notabilis] Length = 102 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKPIPF EEKE Sbjct: 68 PKQRDKVDSIGRLPAPTKPIPFFIEEKE 95 >gb|EXB76038.1| 50S ribosomal protein L15 [Morus notabilis] Length = 279 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKPIPF EEKE Sbjct: 245 PKQRDKVDSIGRLPAPTKPIPFFIEEKE 272 >gb|EMT11945.1| hypothetical protein F775_08463 [Aegilops tauschii] Length = 98 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT+EE E Sbjct: 58 PKQRDKVDSIGRLPAPTKPLPFTSEELE 85 >dbj|BAK00590.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 290 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT+EE E Sbjct: 250 PKQRDKVDSIGRLPAPTKPLPFTSEELE 277 >dbj|BAJ85588.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326505688|dbj|BAJ95515.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 290 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT+EE E Sbjct: 250 PKQRDKVDSIGRLPAPTKPLPFTSEELE 277 >emb|CBH32598.1| 50S ribosomal protein L15, putative, expressed [Triticum aestivum] Length = 297 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT+EE E Sbjct: 257 PKQRDKVDSIGRLPAPTKPLPFTSEELE 284 >tpg|DAA54310.1| TPA: hypothetical protein ZEAMMB73_703096 [Zea mays] Length = 304 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT EE E Sbjct: 265 PKQRDKVDSIGRLPAPTKPLPFTVEELE 292 >ref|XP_002522195.1| 60S ribosomal protein L10, mitochondrial, putative [Ricinus communis] gi|223538566|gb|EEF40170.1| 60S ribosomal protein L10, mitochondrial, putative [Ricinus communis] Length = 275 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKEAM 217 PK KDKVDSIGRLPAPTKPIPF E+KEA+ Sbjct: 242 PKLKDKVDSIGRLPAPTKPIPFYAEDKEAV 271 >ref|NP_001130590.1| uncharacterized protein LOC100191689 [Zea mays] gi|194689570|gb|ACF78869.1| unknown [Zea mays] Length = 127 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 306 PKQKDKVDSIGRLPAPTKPIPFTTEEKE 223 PKQ+DKVDSIGRLPAPTKP+PFT EE E Sbjct: 88 PKQRDKVDSIGRLPAPTKPLPFTVEELE 115