BLASTX nr result
ID: Rehmannia23_contig00030341
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00030341 (307 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] 55 7e-06 >gb|EXB80244.1| hypothetical protein L484_025093 [Morus notabilis] Length = 527 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/46 (50%), Positives = 36/46 (78%) Frame = -1 Query: 238 KHLENDFKVEQKVFLLRMENHGAAIRITERTIVASYSLEIDLGGAY 101 KH + DF+ + KVF+L++ ++G +IRITER VAS+ + +DLGGA+ Sbjct: 4 KHCDQDFRTKHKVFILQITDYGQSIRITERNRVASFDVNLDLGGAF 49