BLASTX nr result
ID: Rehmannia23_contig00029983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029983 (469 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN05718.1| FAR1; Zinc finger, SWIM-type [Medicago truncatula] 62 8e-08 >gb|ABN05718.1| FAR1; Zinc finger, SWIM-type [Medicago truncatula] Length = 800 Score = 62.0 bits (149), Expect = 8e-08 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = -1 Query: 133 SRRYIMVFAPFTGVDNHRRCVTFAFGLLLKEDEESYVWLFENFL 2 + +Y M+FAPFTG+++HR+ +TF LL E EES+VWLFE FL Sbjct: 332 TNKYFMIFAPFTGINHHRQSITFGAALLKNEKEESFVWLFETFL 375