BLASTX nr result
ID: Rehmannia23_contig00029852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029852 (331 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006579168.1| PREDICTED: uncharacterized protein LOC102668... 77 2e-12 ref|XP_006593143.1| PREDICTED: uncharacterized protein LOC102660... 76 4e-12 ref|NP_175304.1| uncharacterized protein [Arabidopsis thaliana] ... 68 1e-09 gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabi... 68 1e-09 gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabi... 68 1e-09 emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] 68 1e-09 gb|ABK28142.1| unknown [Arabidopsis thaliana] 68 1e-09 emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] 68 1e-09 emb|CAB75469.1| copia-type reverse transcriptase-like protein [A... 68 1e-09 gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thal... 68 1e-09 gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] 68 1e-09 ref|XP_006596850.1| PREDICTED: uncharacterized protein LOC102669... 65 7e-09 ref|XP_006590081.1| PREDICTED: uncharacterized protein LOC102666... 65 7e-09 ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665... 65 7e-09 ref|XP_006583762.1| PREDICTED: uncharacterized protein LOC102665... 65 7e-09 ref|XP_006576593.1| PREDICTED: uncharacterized protein LOC102667... 65 7e-09 ref|XP_006605118.1| PREDICTED: uncharacterized protein LOC102669... 65 9e-09 ref|XP_006588127.1| PREDICTED: uncharacterized protein LOC102669... 65 9e-09 ref|XP_006592464.1| PREDICTED: uncharacterized protein LOC102665... 64 2e-08 gb|AAG60131.1|AC073555_15 lectin receptor kinase, putative [Arab... 63 5e-08 >ref|XP_006579168.1| PREDICTED: uncharacterized protein LOC102668417 [Glycine max] Length = 210 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/51 (66%), Positives = 44/51 (86%) Frame = +2 Query: 119 MASVASFQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 ++ VASFQVP LKG+ ++NWSIKMKA LG HDVWE+V KGY+E +DE++LS Sbjct: 3 ISGVASFQVPLLKGSTYDNWSIKMKAFLGEHDVWEMVGKGYKEPQDETSLS 53 >ref|XP_006593143.1| PREDICTED: uncharacterized protein LOC102660881 [Glycine max] Length = 114 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = +2 Query: 128 VASFQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 VASF VP LKG ++NWSIK+KA LGAHDVWE+VEKGY+E +DE++LS Sbjct: 6 VASFHVPLLKGITYDNWSIKIKAFLGAHDVWEMVEKGYKEPQDETSLS 53 >ref|NP_175304.1| uncharacterized protein [Arabidopsis thaliana] gi|51968950|dbj|BAD43167.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] gi|88900318|gb|ABD57471.1| At1g48720 [Arabidopsis thaliana] gi|91805343|gb|ABE65401.1| hypothetical protein At1g48720 [Arabidopsis thaliana] gi|110739223|dbj|BAF01526.1| hypothetical protein [Arabidopsis thaliana] gi|332194218|gb|AEE32339.1| uncharacterized protein AT1G48720 [Arabidopsis thaliana] Length = 97 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >gb|AAG60117.1|AC073555_1 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1352 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >gb|AAG50698.1|AC079604_5 copia-type polyprotein, putative [Arabidopsis thaliana] gi|12321387|gb|AAG50765.1|AC079131_10 copia-type polyprotein, putative [Arabidopsis thaliana] Length = 1320 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >emb|CAA69271.1| lectin receptor kinase [Arabidopsis thaliana] Length = 544 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 24 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 70 >gb|ABK28142.1| unknown [Arabidopsis thaliana] Length = 98 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >emb|CAB71063.1| copia-type polyprotein [Arabidopsis thaliana] Length = 1352 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >emb|CAB75469.1| copia-type reverse transcriptase-like protein [Arabidopsis thaliana] Length = 1272 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >gb|AAD50001.1|AC007259_14 Hypothetical protein [Arabidopsis thaliana] Length = 1352 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >gb|AAF16534.1|AC013482_8 T26F17.17 [Arabidopsis thaliana] Length = 1291 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/47 (59%), Positives = 40/47 (85%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E +LS T Sbjct: 8 FQVPVLTKSNYDNWSLQMKAILGAHDVWEIVEKGFIEPENEGSLSQT 54 >ref|XP_006596850.1| PREDICTED: uncharacterized protein LOC102669510 [Glycine max] Length = 296 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEASLS 51 >ref|XP_006590081.1| PREDICTED: uncharacterized protein LOC102666085 [Glycine max] Length = 296 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEASLS 51 >ref|XP_006590044.1| PREDICTED: uncharacterized protein LOC102665857 [Glycine max] Length = 678 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEASLS 51 >ref|XP_006583762.1| PREDICTED: uncharacterized protein LOC102665045, partial [Glycine max] Length = 163 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEASLS 51 >ref|XP_006576593.1| PREDICTED: uncharacterized protein LOC102667150 [Glycine max] Length = 93 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEASLS 51 >ref|XP_006605118.1| PREDICTED: uncharacterized protein LOC102669108 [Glycine max] Length = 218 Score = 65.1 bits (157), Expect = 9e-09 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +2 Query: 122 ASVASFQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLSST 277 +S+ FQVP L N+++NWSI MKALLG DV E+VEKG+ ET+++ +LS T Sbjct: 4 SSMVPFQVPILNNNNYDNWSINMKALLGVQDVLEIVEKGHTETENKDSLSQT 55 >ref|XP_006588127.1| PREDICTED: uncharacterized protein LOC102669122 [Glycine max] Length = 277 Score = 65.1 bits (157), Expect = 9e-09 Identities = 28/45 (62%), Positives = 39/45 (86%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW+++E G+EE +DE++LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIIENGFEE-QDEASLS 51 >ref|XP_006592464.1| PREDICTED: uncharacterized protein LOC102665448 [Glycine max] Length = 119 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDESTLS 271 FQ+P L N+++NWSIKMKALLGA DVW++VE G+EE +DE +LS Sbjct: 8 FQMPMLTKNNYDNWSIKMKALLGAQDVWDIVENGFEE-QDEVSLS 51 >gb|AAG60131.1|AC073555_15 lectin receptor kinase, putative [Arabidopsis thaliana] Length = 70 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/41 (60%), Positives = 36/41 (87%) Frame = +2 Query: 137 FQVPQLKGNDFENWSIKMKALLGAHDVWEVVEKGYEETKDE 259 FQVP L ++++NWS++MKA+LGAHDVWE+VEKG+ E ++E Sbjct: 8 FQVPVLTKSNYDNWSLRMKAILGAHDVWEIVEKGFIEPENE 48