BLASTX nr result
ID: Rehmannia23_contig00029775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia23_contig00029775 (685 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABP35314.1| ORF84c [Pinus koraiensis] 58 2e-06 gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 57 4e-06 >gb|ABP35314.1| ORF84c [Pinus koraiensis] Length = 84 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/64 (53%), Positives = 42/64 (65%) Frame = +3 Query: 282 FLIVTKSSIFLLDF*RKKLKQNSYSTMTLVY*RHRHIVLARWKTKSFSLGSSQIEIENEV 461 F IVTK S + + +LK+NSY TMTLVY ++H V ARW FS GS +EI NE+ Sbjct: 7 FFIVTKPSTY--GWKDPRLKRNSYRTMTLVYLGYQHFVRARWNL--FSWGSESVEIGNEL 62 Query: 462 TRKI 473 TRKI Sbjct: 63 TRKI 66 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%), Gaps = 3/31 (9%) Frame = -1 Query: 685 RGYSRRRFS---VSNSKPNMKLWFHSAPLWK 602 +GYSRRRFS VSNSKPNMKLWFHSAPLW+ Sbjct: 27 KGYSRRRFSSLSVSNSKPNMKLWFHSAPLWR 57